BLASTX nr result
ID: Coptis24_contig00017150
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00017150 (318 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EJY66653.1| hypothetical protein OXYTRI_13058 [Oxytricha trif... 83 3e-14 gb|EJY65597.1| hypothetical protein OXYTRI_14248 [Oxytricha trif... 83 3e-14 gb|ELU05225.1| hypothetical protein CAPTEDRAFT_108619, partial [... 77 1e-12 ref|XP_003580983.1| PREDICTED: uncharacterized protein LOC100832... 60 9e-12 ref|XP_002488956.1| hypothetical protein SORBIDRAFT_1211s002020 ... 60 4e-11 >gb|EJY66653.1| hypothetical protein OXYTRI_13058 [Oxytricha trifallax] Length = 1367 Score = 82.8 bits (203), Expect = 3e-14 Identities = 40/58 (68%), Positives = 43/58 (74%) Frame = +2 Query: 2 YPEGNFGGNQLLNDSIGLSPLYSSLTNDLHVSTATTFHQDFSWLRSTQA*LVVFRDLT 175 YPEGNFGGNQLL+ SI LSPLY S T DLHV TAT+ HQ F WL TQA +FR LT Sbjct: 740 YPEGNFGGNQLLDGSISLSPLYPSSTIDLHVRTATSLHQSFPWLHPTQAQFTIFRVLT 797 >gb|EJY65597.1| hypothetical protein OXYTRI_14248 [Oxytricha trifallax] Length = 1367 Score = 82.8 bits (203), Expect = 3e-14 Identities = 40/58 (68%), Positives = 43/58 (74%) Frame = +2 Query: 2 YPEGNFGGNQLLNDSIGLSPLYSSLTNDLHVSTATTFHQDFSWLRSTQA*LVVFRDLT 175 YPEGNFGGNQLL+ SI LSPLY S T DLHV TAT+ HQ F WL TQA +FR LT Sbjct: 740 YPEGNFGGNQLLDGSISLSPLYPSSTIDLHVRTATSLHQSFPWLHPTQAQFTIFRVLT 797 >gb|ELU05225.1| hypothetical protein CAPTEDRAFT_108619, partial [Capitella teleta] Length = 53 Score = 77.4 bits (189), Expect = 1e-12 Identities = 36/49 (73%), Positives = 38/49 (77%) Frame = +2 Query: 2 YPEGNFGGNQLLNDSIGLSPLYSSLTNDLHVSTATTFHQDFSWLRSTQA 148 YPEGNFGGNQLL+ SI LSPLY+SLT DLHV TA HQ F WLR QA Sbjct: 5 YPEGNFGGNQLLDGSISLSPLYTSLTIDLHVRTAAALHQSFPWLRPAQA 53 >ref|XP_003580983.1| PREDICTED: uncharacterized protein LOC100832610 [Brachypodium distachyon] gi|357167133|ref|XP_003581019.1| PREDICTED: uncharacterized protein LOC100823731 [Brachypodium distachyon] gi|357167213|ref|XP_003581055.1| PREDICTED: uncharacterized protein LOC100841398 [Brachypodium distachyon] gi|357167266|ref|XP_003581080.1| PREDICTED: uncharacterized protein LOC100827247 [Brachypodium distachyon] gi|238012726|gb|ACR37398.1| unknown [Zea mays] Length = 65 Score = 60.1 bits (144), Expect(2) = 9e-12 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = +3 Query: 45 RLVFRPYTQV*QTICTSVLLRPSTKISPGFGLLKHSSSFFGT 170 RLVFRPYTQV +TICTSV LR ST++S GF L+HSS FG+ Sbjct: 3 RLVFRPYTQVRRTICTSVSLRASTRVSSGFAPLRHSSPSFGS 44 Score = 34.7 bits (78), Expect(2) = 9e-12 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = +1 Query: 166 GPNMTCSNSNPSPKARLGEQCG 231 G CSNSNPS K R+G++CG Sbjct: 43 GSRQACSNSNPSQKIRVGQRCG 64 >ref|XP_002488956.1| hypothetical protein SORBIDRAFT_1211s002020 [Sorghum bicolor] gi|253759995|ref|XP_002488958.1| hypothetical protein SORBIDRAFT_1184s002010 [Sorghum bicolor] gi|253761162|ref|XP_002489054.1| hypothetical protein SORBIDRAFT_0208s002040 [Sorghum bicolor] gi|253761217|ref|XP_002489066.1| hypothetical protein SORBIDRAFT_0177s002020 [Sorghum bicolor] gi|253761435|ref|XP_002489115.1| hypothetical protein SORBIDRAFT_0057s002020 [Sorghum bicolor] gi|253761554|ref|XP_002489154.1| hypothetical protein SORBIDRAFT_0016s002500 [Sorghum bicolor] gi|253761556|ref|XP_002489155.1| hypothetical protein SORBIDRAFT_0016s002510 [Sorghum bicolor] gi|253761558|ref|XP_002489156.1| hypothetical protein SORBIDRAFT_0016s002520 [Sorghum bicolor] gi|241947002|gb|EES20147.1| hypothetical protein SORBIDRAFT_1184s002010 [Sorghum bicolor] gi|241947050|gb|EES20195.1| hypothetical protein SORBIDRAFT_1211s002020 [Sorghum bicolor] gi|241947189|gb|EES20334.1| hypothetical protein SORBIDRAFT_0016s002500 [Sorghum bicolor] gi|241947190|gb|EES20335.1| hypothetical protein SORBIDRAFT_0016s002510 [Sorghum bicolor] gi|241947191|gb|EES20336.1| hypothetical protein SORBIDRAFT_0016s002520 [Sorghum bicolor] gi|241947201|gb|EES20346.1| hypothetical protein SORBIDRAFT_0177s002020 [Sorghum bicolor] gi|241947261|gb|EES20406.1| hypothetical protein SORBIDRAFT_0208s002040 [Sorghum bicolor] gi|241947366|gb|EES20511.1| hypothetical protein SORBIDRAFT_0057s002020 [Sorghum bicolor] Length = 65 Score = 60.1 bits (144), Expect(2) = 4e-11 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = +3 Query: 45 RLVFRPYTQV*QTICTSVLLRPSTKISPGFGLLKHSSSFFGT 170 RLVFRPYTQV +TICTSV LR ST++S GF L+HSS FG+ Sbjct: 3 RLVFRPYTQVRRTICTSVSLRASTRVSSGFAPLRHSSPSFGS 44 Score = 32.3 bits (72), Expect(2) = 4e-11 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +1 Query: 166 GPNMTCSNSNPSPKARLGEQC 228 G CSNSNPS K R+G++C Sbjct: 43 GSRQACSNSNPSQKIRVGQRC 63