BLASTX nr result
ID: Coptis24_contig00017028
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00017028 (237 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003539578.1| PREDICTED: probable disease resistance prote... 62 6e-08 ref|XP_002325344.1| BED finger-nbs-lrr resistance protein [Popul... 58 7e-07 ref|XP_002337280.1| BED finger-nbs-lrr resistance protein [Popul... 58 7e-07 ref|XP_002325714.1| BED finger-nbs-lrr resistance protein [Popul... 58 9e-07 ref|NP_194452.1| NB-ARC domain-containing disease resistance pro... 57 2e-06 >ref|XP_003539578.1| PREDICTED: probable disease resistance protein At4g27220-like [Glycine max] Length = 962 Score = 61.6 bits (148), Expect = 6e-08 Identities = 33/74 (44%), Positives = 48/74 (64%), Gaps = 3/74 (4%) Frame = +1 Query: 1 DVKVEPLSEDEAWELFLVNVGEE--LXXXXXXXXXXXXXXCCGLPLAIVTIGRSLRR-KD 171 +VKVEPL+++EAW LFL N+G++ L C GLPLAI+T+ RS+R ++ Sbjct: 290 NVKVEPLAKEEAWTLFLDNLGQQTTLSPEVTKVARSVAKECAGLPLAIITMARSMRGVEE 349 Query: 172 VDEWRVALSDLRES 213 + EWR AL +LR + Sbjct: 350 ICEWRHALEELRNT 363 >ref|XP_002325344.1| BED finger-nbs-lrr resistance protein [Populus trichocarpa] gi|222862219|gb|EEE99725.1| BED finger-nbs-lrr resistance protein [Populus trichocarpa] Length = 1176 Score = 58.2 bits (139), Expect = 7e-07 Identities = 32/73 (43%), Positives = 43/73 (58%), Gaps = 3/73 (4%) Frame = +1 Query: 4 VKVEPLSEDEAWELFLVNVGEE--LXXXXXXXXXXXXXXCCGLPLAIVTIGRSLRR-KDV 174 +K++PLSE EAW LF+ +G++ L C GLPL I+T+ RSLR D+ Sbjct: 514 IKLKPLSESEAWTLFMEKLGDDKALSPEVEQIAVDVARECAGLPLGIITVARSLRGVDDL 573 Query: 175 DEWRVALSDLRES 213 EWR L+ LRES Sbjct: 574 YEWRNTLNKLRES 586 >ref|XP_002337280.1| BED finger-nbs-lrr resistance protein [Populus trichocarpa] gi|222838678|gb|EEE77043.1| BED finger-nbs-lrr resistance protein [Populus trichocarpa] Length = 577 Score = 58.2 bits (139), Expect = 7e-07 Identities = 32/74 (43%), Positives = 42/74 (56%), Gaps = 3/74 (4%) Frame = +1 Query: 1 DVKVEPLSEDEAWELFLVNVGEE--LXXXXXXXXXXXXXXCCGLPLAIVTIGRSLRR-KD 171 ++KV+PLS EAW+LF+ +G + L C GLPL I+TI SLRR D Sbjct: 300 EIKVKPLSNSEAWDLFMEKLGHDMPLSLEVERIAVDIARECAGLPLGIITIAGSLRRVDD 359 Query: 172 VDEWRVALSDLRES 213 + EWR L L+ES Sbjct: 360 LHEWRNTLKKLKES 373 >ref|XP_002325714.1| BED finger-nbs-lrr resistance protein [Populus trichocarpa] gi|222862589|gb|EEF00096.1| BED finger-nbs-lrr resistance protein [Populus trichocarpa] Length = 1010 Score = 57.8 bits (138), Expect = 9e-07 Identities = 33/74 (44%), Positives = 43/74 (58%), Gaps = 3/74 (4%) Frame = +1 Query: 1 DVKVEPLSEDEAWELFLVNVGEE--LXXXXXXXXXXXXXXCCGLPLAIVTIGRSLRR-KD 171 ++KV+PLSE+EAW+LF +G + L C GLPL I+TI SLRR D Sbjct: 321 EIKVKPLSENEAWDLFKEKLGRDISLTPKVERIAVDIARECDGLPLGIITIAGSLRRVDD 380 Query: 172 VDEWRVALSDLRES 213 + EWR L L+ES Sbjct: 381 LHEWRNTLKKLKES 394 >ref|NP_194452.1| NB-ARC domain-containing disease resistance protein [Arabidopsis thaliana] gi|46395628|sp|O81825.1|DRL28_ARATH RecName: Full=Probable disease resistance protein At4g27220 gi|3269283|emb|CAA19716.1| putative protein [Arabidopsis thaliana] gi|7269575|emb|CAB79577.1| putative protein [Arabidopsis thaliana] gi|91806732|gb|ABE66093.1| disease resistance protein [Arabidopsis thaliana] gi|332659912|gb|AEE85312.1| NB-ARC domain-containing disease resistance protein [Arabidopsis thaliana] Length = 919 Score = 57.0 bits (136), Expect = 2e-06 Identities = 34/73 (46%), Positives = 42/73 (57%), Gaps = 2/73 (2%) Frame = +1 Query: 1 DVKVEPLSEDEAWELFLVNVGEELXXXXXXXXXXXXXX-CCGLPLAIVTIGRSLRRK-DV 174 ++KV L E EAWELF NVGE CCGLPLAI+TIGR+LR K V Sbjct: 266 NIKVACLQEKEAWELFCHNVGEVANSDNVKPIAKDVSHECCGLPLAIITIGRTLRGKPQV 325 Query: 175 DEWRVALSDLRES 213 + W+ L+ L+ S Sbjct: 326 EVWKHTLNLLKRS 338