BLASTX nr result
ID: Coptis24_contig00016830
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00016830 (312 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004134836.1| PREDICTED: UPF0548 protein At2g17695-like [C... 60 2e-07 ref|XP_002327717.1| predicted protein [Populus trichocarpa] gi|2... 59 4e-07 ref|NP_001237163.1| uncharacterized protein LOC100527004 [Glycin... 59 5e-07 ref|XP_003629220.1| hypothetical protein MTR_8g074720 [Medicago ... 56 3e-06 gb|AFX67009.1| hypothetical protein [Solanum tuberosum] 56 3e-06 >ref|XP_004134836.1| PREDICTED: UPF0548 protein At2g17695-like [Cucumis sativus] gi|449491283|ref|XP_004158849.1| PREDICTED: UPF0548 protein At2g17695-like [Cucumis sativus] Length = 208 Score = 59.7 bits (143), Expect = 2e-07 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = +1 Query: 193 MVFLCWKRPSELEQKACIDKCGTFNYDSKYRAATSKSFS 309 MVFLCW RPS EQKACI++ G+FNY+SK+R AT+ S Sbjct: 1 MVFLCWSRPSPQEQKACIERAGSFNYNSKFRGATANPSS 39 >ref|XP_002327717.1| predicted protein [Populus trichocarpa] gi|222836802|gb|EEE75195.1| predicted protein [Populus trichocarpa] Length = 202 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/40 (67%), Positives = 30/40 (75%) Frame = +1 Query: 193 MVFLCWKRPSELEQKACIDKCGTFNYDSKYRAATSKSFSS 312 MVFLCW +PS EQK C++K FNYDSKYR ATSK SS Sbjct: 1 MVFLCWAKPSLQEQKDCLNKSDGFNYDSKYRGATSKHASS 40 >ref|NP_001237163.1| uncharacterized protein LOC100527004 [Glycine max] gi|255631350|gb|ACU16042.1| unknown [Glycine max] Length = 207 Score = 58.5 bits (140), Expect = 5e-07 Identities = 25/40 (62%), Positives = 31/40 (77%) Frame = +1 Query: 193 MVFLCWKRPSELEQKACIDKCGTFNYDSKYRAATSKSFSS 312 M+FL W RPS +QK CI+K GTFNYD KY+ AT+KS +S Sbjct: 1 MLFLSWGRPSPQDQKTCINKSGTFNYDDKYKGATAKSVAS 40 >ref|XP_003629220.1| hypothetical protein MTR_8g074720 [Medicago truncatula] gi|355523242|gb|AET03696.1| hypothetical protein MTR_8g074720 [Medicago truncatula] Length = 232 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/41 (58%), Positives = 31/41 (75%) Frame = +1 Query: 190 KMVFLCWKRPSELEQKACIDKCGTFNYDSKYRAATSKSFSS 312 +MVFL W RP+ +QK CI+K GT NYD KY+ A++KS SS Sbjct: 23 RMVFLSWVRPTAQDQKNCINKSGTLNYDDKYKGASAKSLSS 63 >gb|AFX67009.1| hypothetical protein [Solanum tuberosum] Length = 203 Score = 55.8 bits (133), Expect = 3e-06 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = +1 Query: 193 MVFLCWKRPSELEQKACIDKCGTFNYDSKYRAATSK 300 MVFL W RPS EQKACI+K G+FNYD+++R AT K Sbjct: 1 MVFLSWTRPSPDEQKACINKSGSFNYDNRFRGATDK 36