BLASTX nr result
ID: Coptis24_contig00016354
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00016354 (201 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_199853.1| peptide-O-fucosyltransferase [Arabidopsis thali... 58 7e-07 gb|AAM66093.1| unknown [Arabidopsis thaliana] 58 7e-07 ref|XP_003627474.1| GDP-fucose protein-O-fucosyltransferase [Med... 56 3e-06 ref|XP_003632783.1| PREDICTED: uncharacterized protein LOC100254... 55 5e-06 ref|XP_002865803.1| hypothetical protein ARALYDRAFT_918074 [Arab... 55 5e-06 >ref|NP_199853.1| peptide-O-fucosyltransferase [Arabidopsis thaliana] gi|9758924|dbj|BAB09461.1| unnamed protein product [Arabidopsis thaliana] gi|133778858|gb|ABO38769.1| At5g50420 [Arabidopsis thaliana] gi|332008558|gb|AED95941.1| peptide-O-fucosyltransferase [Arabidopsis thaliana] Length = 566 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/60 (45%), Positives = 39/60 (65%) Frame = +2 Query: 20 MLVEDFRSVVLKQIKVNKEVQQILLSSHRVGNVSEFLDANSMVVGYSGCRKADDGMGERR 199 +L ED +S V KQI +NKE+Q++LLS HR N S D +S+ Y+ CRK D + +R+ Sbjct: 148 VLFEDVKSAVSKQISLNKEIQEVLLSPHRSSNYSGGTDVDSVNFSYNRCRKVDQKLSDRK 207 >gb|AAM66093.1| unknown [Arabidopsis thaliana] Length = 566 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/60 (45%), Positives = 39/60 (65%) Frame = +2 Query: 20 MLVEDFRSVVLKQIKVNKEVQQILLSSHRVGNVSEFLDANSMVVGYSGCRKADDGMGERR 199 +L ED +S V KQI +NKE+Q++LLS HR N S D +S+ Y+ CRK D + +R+ Sbjct: 148 VLFEDVKSAVSKQISLNKEIQEVLLSPHRSSNYSGGTDVDSVNFSYNRCRKVDQKLSDRK 207 >ref|XP_003627474.1| GDP-fucose protein-O-fucosyltransferase [Medicago truncatula] gi|355521496|gb|AET01950.1| GDP-fucose protein-O-fucosyltransferase [Medicago truncatula] Length = 542 Score = 55.8 bits (133), Expect = 3e-06 Identities = 27/63 (42%), Positives = 39/63 (61%), Gaps = 4/63 (6%) Frame = +2 Query: 23 LVEDFRSVVLKQIKVNKEVQQILLSSHRVGNVSE----FLDANSMVVGYSGCRKADDGMG 190 L+ED +S + KQI +N E+QQILL+ HR GNV + F ++N V Y CR D + Sbjct: 122 LIEDLKSALFKQISINNEIQQILLNPHRTGNVIDPEFNFGNSNFNVGNYDRCRTVDQSLS 181 Query: 191 ERR 199 +R+ Sbjct: 182 KRK 184 >ref|XP_003632783.1| PREDICTED: uncharacterized protein LOC100254979 isoform 2 [Vitis vinifera] Length = 603 Score = 55.5 bits (132), Expect = 5e-06 Identities = 27/59 (45%), Positives = 39/59 (66%), Gaps = 4/59 (6%) Frame = +2 Query: 32 DFRSVVLKQIKVNKEVQQILLSSHRVGNVSEFLDANSMV----VGYSGCRKADDGMGER 196 DF+S +LKQI +NKE+QQ+LLSSH GN+SE +D N + ++ C K + M +R Sbjct: 143 DFKSALLKQISLNKEIQQVLLSSHPSGNLSELVDDNGDLNFGAYSFNRCPKVNQNMSQR 201 >ref|XP_002865803.1| hypothetical protein ARALYDRAFT_918074 [Arabidopsis lyrata subsp. lyrata] gi|297311638|gb|EFH42062.1| hypothetical protein ARALYDRAFT_918074 [Arabidopsis lyrata subsp. lyrata] Length = 566 Score = 55.5 bits (132), Expect = 5e-06 Identities = 26/60 (43%), Positives = 37/60 (61%) Frame = +2 Query: 20 MLVEDFRSVVLKQIKVNKEVQQILLSSHRVGNVSEFLDANSMVVGYSGCRKADDGMGERR 199 +L ED +S V KQI +NKE+Q +LLS HR N S + +S+ Y CRK D + +R+ Sbjct: 148 VLFEDVKSAVSKQISLNKEIQNVLLSPHRSSNYSGGTEVDSVNFSYDRCRKVDQKLSDRK 207