BLASTX nr result
ID: Coptis24_contig00015360
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00015360 (825 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003616184.1| Armadillo repeat-containing protein [Medicag... 95 2e-17 ref|NP_001242327.1| uncharacterized protein LOC100790639 [Glycin... 92 1e-16 ref|XP_002270403.1| PREDICTED: armadillo repeat-containing prote... 91 2e-16 ref|XP_002298151.1| predicted protein [Populus trichocarpa] gi|2... 89 2e-15 ref|NP_198545.1| armadillo/beta-catenin-like repeat-containing p... 83 9e-14 >ref|XP_003616184.1| Armadillo repeat-containing protein [Medicago truncatula] gi|355517519|gb|AES99142.1| Armadillo repeat-containing protein [Medicago truncatula] gi|388504388|gb|AFK40260.1| unknown [Medicago truncatula] Length = 178 Score = 94.7 bits (234), Expect = 2e-17 Identities = 44/54 (81%), Positives = 51/54 (94%) Frame = -1 Query: 825 VNYALGALYYLCNNSNKEEILKPEVVEVIKRYAAAGAVSVSFSNLAQAFMEKHL 664 VNYALGALYY+CN SNKEE+LKPEV++VIKRYAAA VSVSFSNLA+AF++KHL Sbjct: 121 VNYALGALYYICNESNKEEVLKPEVIDVIKRYAAAEEVSVSFSNLAKAFLDKHL 174 >ref|NP_001242327.1| uncharacterized protein LOC100790639 [Glycine max] gi|255647064|gb|ACU24000.1| unknown [Glycine max] Length = 178 Score = 92.4 bits (228), Expect = 1e-16 Identities = 44/54 (81%), Positives = 50/54 (92%) Frame = -1 Query: 825 VNYALGALYYLCNNSNKEEILKPEVVEVIKRYAAAGAVSVSFSNLAQAFMEKHL 664 VNYALGALYY+CN SNKEEIL+PEVV+VI+RYAAA VSVSFSNLA+AF+ KHL Sbjct: 121 VNYALGALYYICNESNKEEILRPEVVDVIRRYAAAEEVSVSFSNLAKAFLSKHL 174 >ref|XP_002270403.1| PREDICTED: armadillo repeat-containing protein 7 [Vitis vinifera] gi|297738150|emb|CBI27351.3| unnamed protein product [Vitis vinifera] Length = 177 Score = 91.3 bits (225), Expect = 2e-16 Identities = 40/54 (74%), Positives = 52/54 (96%) Frame = -1 Query: 825 VNYALGALYYLCNNSNKEEILKPEVVEVIKRYAAAGAVSVSFSNLAQAFMEKHL 664 VNY +GALYY+CN SNKEEI++PEVV+VIK+YAAAG+VSV+FSNLA+AF++KH+ Sbjct: 121 VNYGIGALYYICNESNKEEIVRPEVVDVIKKYAAAGSVSVNFSNLAKAFLDKHV 174 >ref|XP_002298151.1| predicted protein [Populus trichocarpa] gi|222845409|gb|EEE82956.1| predicted protein [Populus trichocarpa] Length = 178 Score = 88.6 bits (218), Expect = 2e-15 Identities = 41/54 (75%), Positives = 50/54 (92%) Frame = -1 Query: 825 VNYALGALYYLCNNSNKEEILKPEVVEVIKRYAAAGAVSVSFSNLAQAFMEKHL 664 VNYALG+LYYLCN+S KEEILKPEV++VIKRYAA V+VSFSNLA+AF++KH+ Sbjct: 121 VNYALGSLYYLCNSSTKEEILKPEVLDVIKRYAACETVNVSFSNLAKAFLDKHV 174 >ref|NP_198545.1| armadillo/beta-catenin-like repeat-containing protein [Arabidopsis thaliana] gi|9758715|dbj|BAB09101.1| unnamed protein product [Arabidopsis thaliana] gi|98960935|gb|ABF58951.1| At5g37290 [Arabidopsis thaliana] gi|332006778|gb|AED94161.1| armadillo/beta-catenin-like repeat-containing protein [Arabidopsis thaliana] Length = 180 Score = 82.8 bits (203), Expect = 9e-14 Identities = 40/60 (66%), Positives = 52/60 (86%), Gaps = 2/60 (3%) Frame = -1 Query: 825 VNYALGALYYLC--NNSNKEEILKPEVVEVIKRYAAAGAVSVSFSNLAQAFMEKHLPGQT 652 VNYALGALYY+C N + +EEIL+PEVV++I+RYAAA +VSVSFSNLA+AF++KH+ T Sbjct: 121 VNYALGALYYMCDYNRATREEILRPEVVDLIERYAAAESVSVSFSNLAKAFLDKHVHANT 180