BLASTX nr result
ID: Coptis24_contig00015337
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00015337 (281 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283439.2| PREDICTED: probable disease resistance prote... 55 6e-06 >ref|XP_002283439.2| PREDICTED: probable disease resistance protein At4g27220-like [Vitis vinifera] Length = 1276 Score = 55.1 bits (131), Expect = 6e-06 Identities = 31/71 (43%), Positives = 37/71 (52%), Gaps = 6/71 (8%) Frame = -3 Query: 279 HCPNLEVITVCRCRKMEELLTAGEDSGEWSTSNTTSTIR------VPRLQILWLKELPKL 118 H NL+ I V CR+ME+L+ A E E R P LQ L L+ LPKL Sbjct: 1114 HLKNLQSIDVGNCRQMEDLIVAAEVEEEEEEEEEVINQRHNLILYFPNLQSLTLENLPKL 1173 Query: 117 ESIWKGVMACD 85 +SIWKG M CD Sbjct: 1174 KSIWKGTMTCD 1184