BLASTX nr result
ID: Coptis24_contig00015293
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00015293 (207 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003569790.1| PREDICTED: golgin-84-like [Brachypodium dist... 57 1e-06 >ref|XP_003569790.1| PREDICTED: golgin-84-like [Brachypodium distachyon] Length = 712 Score = 57.4 bits (137), Expect = 1e-06 Identities = 34/62 (54%), Positives = 40/62 (64%), Gaps = 15/62 (24%) Frame = +3 Query: 3 WLKVAEDLLEVVDRRAKSVASE---------------QEIQARSIKQKEKAQLRLSTIDA 137 WLKVAEDLLEVVDRRAKSVA+E QE QA+ K EK L+L+T+DA Sbjct: 4 WLKVAEDLLEVVDRRAKSVATELSDEQPSSQPSGSSGQEGQAKRGKSSEKGPLKLTTVDA 63 Query: 138 SE 143 S+ Sbjct: 64 SK 65