BLASTX nr result
ID: Coptis24_contig00014834
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00014834 (312 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002277091.1| PREDICTED: frataxin, mitochondrial isoform 1... 91 1e-16 emb|CAN67530.1| hypothetical protein VITISV_004311 [Vitis vinifera] 91 1e-16 ref|XP_002531340.1| Frataxin, mitochondrial precursor, putative ... 89 3e-16 ref|XP_004139965.1| PREDICTED: frataxin, mitochondrial-like [Cuc... 88 6e-16 ref|XP_002319394.1| predicted protein [Populus trichocarpa] gi|2... 88 8e-16 >ref|XP_002277091.1| PREDICTED: frataxin, mitochondrial isoform 1 [Vitis vinifera] gi|296081250|emb|CBI17994.3| unnamed protein product [Vitis vinifera] Length = 197 Score = 90.9 bits (224), Expect = 1e-16 Identities = 41/50 (82%), Positives = 47/50 (94%) Frame = -1 Query: 312 LWLSSPVSGPSRFDWDKSSQAWVYRRTKANLLWLLESEVEQLCGEPISLS 163 +WLSSPVSGPSRFDWD+S+QAWVYRRTKANL LLE+E+E+LCG PISLS Sbjct: 148 IWLSSPVSGPSRFDWDQSAQAWVYRRTKANLSKLLETELEKLCGTPISLS 197 >emb|CAN67530.1| hypothetical protein VITISV_004311 [Vitis vinifera] Length = 202 Score = 90.9 bits (224), Expect = 1e-16 Identities = 41/50 (82%), Positives = 47/50 (94%) Frame = -1 Query: 312 LWLSSPVSGPSRFDWDKSSQAWVYRRTKANLLWLLESEVEQLCGEPISLS 163 +WLSSPVSGPSRFDWD+S+QAWVYRRTKANL LLE+E+E+LCG PISLS Sbjct: 153 IWLSSPVSGPSRFDWDQSAQAWVYRRTKANLSKLLETELEKLCGTPISLS 202 >ref|XP_002531340.1| Frataxin, mitochondrial precursor, putative [Ricinus communis] gi|223529062|gb|EEF31047.1| Frataxin, mitochondrial precursor, putative [Ricinus communis] Length = 200 Score = 89.4 bits (220), Expect = 3e-16 Identities = 38/50 (76%), Positives = 47/50 (94%) Frame = -1 Query: 312 LWLSSPVSGPSRFDWDKSSQAWVYRRTKANLLWLLESEVEQLCGEPISLS 163 LWLSSPVSGPSR+DWD++++AWVYRRTKANL +LESE+EQ+CGEPI L+ Sbjct: 151 LWLSSPVSGPSRYDWDRNAEAWVYRRTKANLFEVLESELEQVCGEPIKLA 200 >ref|XP_004139965.1| PREDICTED: frataxin, mitochondrial-like [Cucumis sativus] Length = 191 Score = 88.2 bits (217), Expect = 6e-16 Identities = 38/50 (76%), Positives = 45/50 (90%) Frame = -1 Query: 312 LWLSSPVSGPSRFDWDKSSQAWVYRRTKANLLWLLESEVEQLCGEPISLS 163 +WLSSP+SGPSRFDWD++SQ W+YRR KANLL LLE+E+ QLCGEPI LS Sbjct: 142 IWLSSPLSGPSRFDWDQNSQTWIYRRNKANLLSLLETELTQLCGEPIDLS 191 >ref|XP_002319394.1| predicted protein [Populus trichocarpa] gi|222857770|gb|EEE95317.1| predicted protein [Populus trichocarpa] Length = 192 Score = 87.8 bits (216), Expect = 8e-16 Identities = 41/50 (82%), Positives = 45/50 (90%) Frame = -1 Query: 312 LWLSSPVSGPSRFDWDKSSQAWVYRRTKANLLWLLESEVEQLCGEPISLS 163 LWLSSPVSGPSRFDWD+S QAWVYRRTKANLL +LESE+ QL GEPI L+ Sbjct: 143 LWLSSPVSGPSRFDWDRSDQAWVYRRTKANLLNVLESEMGQLFGEPIKLA 192