BLASTX nr result
ID: Coptis24_contig00014460
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00014460 (433 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI36413.3| unnamed protein product [Vitis vinifera] 58 7e-07 >emb|CBI36413.3| unnamed protein product [Vitis vinifera] Length = 174 Score = 58.2 bits (139), Expect = 7e-07 Identities = 29/76 (38%), Positives = 51/76 (67%), Gaps = 3/76 (3%) Frame = +3 Query: 213 NKMVYSTMETLLLDTV---RNPLVSLLMMIGSMPNNVAAVLPKVPDTDERISLVEASKVK 383 ++++ S +E ++++T +V LL++IGS+PN++ +LPK P DER + + K+K Sbjct: 15 DRVLCSLVEAVVVETTLVAHKSVVWLLLLIGSLPNDID-LLPKAPVADERFPIADLKKMK 73 Query: 384 QPNPECKDASETEDDD 431 +P E KDA+E +DDD Sbjct: 74 RPETENKDANEDDDDD 89