BLASTX nr result
ID: Coptis24_contig00014414
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00014414 (468 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002298593.1| predicted protein [Populus trichocarpa] gi|2... 119 3e-25 ref|XP_002516169.1| dimethylaniline monooxygenase, putative [Ric... 115 3e-24 emb|CBI27765.3| unnamed protein product [Vitis vinifera] 113 2e-23 ref|XP_002277560.1| PREDICTED: probable flavin-containing monoox... 113 2e-23 ref|XP_002516225.1| dimethylaniline monooxygenase, putative [Ric... 110 9e-23 >ref|XP_002298593.1| predicted protein [Populus trichocarpa] gi|222845851|gb|EEE83398.1| predicted protein [Populus trichocarpa] Length = 524 Score = 119 bits (298), Expect = 3e-25 Identities = 52/71 (73%), Positives = 61/71 (85%) Frame = -1 Query: 468 PTIRNMLEQTSKEEKVMQKTTRFYKRHCISTFSINHSDEICKEMGWGFWRKKNWLLEAFS 289 P I MLEQT++E +VM++TTRFYKRHCISTFSINHSD+IC+EMGW WRKKNW EAFS Sbjct: 452 PGIEKMLEQTNEEIQVMKRTTRFYKRHCISTFSINHSDDICEEMGWNSWRKKNWFSEAFS 511 Query: 288 PYSNQDYIEKK 256 PY++QDY E K Sbjct: 512 PYNSQDYDENK 522 >ref|XP_002516169.1| dimethylaniline monooxygenase, putative [Ricinus communis] gi|223544655|gb|EEF46171.1| dimethylaniline monooxygenase, putative [Ricinus communis] Length = 522 Score = 115 bits (289), Expect = 3e-24 Identities = 50/71 (70%), Positives = 63/71 (88%) Frame = -1 Query: 468 PTIRNMLEQTSKEEKVMQKTTRFYKRHCISTFSINHSDEICKEMGWGFWRKKNWLLEAFS 289 P+I M+EQT++E ++M++TTRFYKRHCIST+SINHSDEIC+EMGW WRK+N LEAFS Sbjct: 450 PSIGKMIEQTTEEIEIMKRTTRFYKRHCISTYSINHSDEICEEMGWNPWRKRNLFLEAFS 509 Query: 288 PYSNQDYIEKK 256 PY++QDY EKK Sbjct: 510 PYNSQDYQEKK 520 >emb|CBI27765.3| unnamed protein product [Vitis vinifera] Length = 456 Score = 113 bits (282), Expect = 2e-23 Identities = 48/71 (67%), Positives = 62/71 (87%) Frame = -1 Query: 468 PTIRNMLEQTSKEEKVMQKTTRFYKRHCISTFSINHSDEICKEMGWGFWRKKNWLLEAFS 289 P++ M+E+T+ E +VM+KTTRFYKR CIST+SINHSDEIC+EMGW WRKK+WL EAFS Sbjct: 386 PSVEKMIEKTNNETEVMKKTTRFYKRGCISTYSINHSDEICEEMGWTSWRKKSWLSEAFS 445 Query: 288 PYSNQDYIEKK 256 PY+++DY E+K Sbjct: 446 PYNSEDYGEEK 456 >ref|XP_002277560.1| PREDICTED: probable flavin-containing monooxygenase 1 [Vitis vinifera] Length = 522 Score = 113 bits (282), Expect = 2e-23 Identities = 48/71 (67%), Positives = 62/71 (87%) Frame = -1 Query: 468 PTIRNMLEQTSKEEKVMQKTTRFYKRHCISTFSINHSDEICKEMGWGFWRKKNWLLEAFS 289 P++ M+E+T+ E +VM+KTTRFYKR CIST+SINHSDEIC+EMGW WRKK+WL EAFS Sbjct: 452 PSVEKMIEKTNNETEVMKKTTRFYKRGCISTYSINHSDEICEEMGWTSWRKKSWLSEAFS 511 Query: 288 PYSNQDYIEKK 256 PY+++DY E+K Sbjct: 512 PYNSEDYGEEK 522 >ref|XP_002516225.1| dimethylaniline monooxygenase, putative [Ricinus communis] gi|223544711|gb|EEF46227.1| dimethylaniline monooxygenase, putative [Ricinus communis] Length = 521 Score = 110 bits (276), Expect = 9e-23 Identities = 50/68 (73%), Positives = 57/68 (83%), Gaps = 1/68 (1%) Frame = -1 Query: 468 PTIRNMLEQTSKEEKVMQKTTRFYKR-HCISTFSINHSDEICKEMGWGFWRKKNWLLEAF 292 PT+ MLEQ SKE + M++TTRFYK+ HCISTFSINHSDEIC+EMGW WRKKN+L EAF Sbjct: 451 PTVEKMLEQVSKEIEAMKRTTRFYKKKHCISTFSINHSDEICEEMGWSSWRKKNFLAEAF 510 Query: 291 SPYSNQDY 268 SPY QDY Sbjct: 511 SPYGTQDY 518