BLASTX nr result
ID: Coptis24_contig00014393
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00014393 (391 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002891574.1| SNF2 domain-containing protein [Arabidopsis ... 226 2e-57 ref|XP_002267403.2| PREDICTED: uncharacterized ATP-dependent hel... 221 4e-56 emb|CBI35366.3| unnamed protein product [Vitis vinifera] 221 4e-56 gb|AAF87890.1|AC012561_23 Similar tp transcription factors [Arab... 220 1e-55 ref|NP_564568.1| SNF2 and helicase domain-containing protein [Ar... 220 1e-55 >ref|XP_002891574.1| SNF2 domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297337416|gb|EFH67833.1| SNF2 domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 980 Score = 226 bits (575), Expect = 2e-57 Identities = 108/130 (83%), Positives = 120/130 (92%) Frame = +2 Query: 2 RTQVARACCGLRAKRRWCLSGTPIQNSIDDLFSYFRFLKYDPYAVFGAFCIAIKLPISRN 181 RTQVARACCGLRAKRRWCLSGTPIQN+IDDL+SYFRFLKYDPYAV+ +FC IK PISRN Sbjct: 486 RTQVARACCGLRAKRRWCLSGTPIQNTIDDLYSYFRFLKYDPYAVYKSFCHQIKGPISRN 545 Query: 182 ASHGYKKLQAVLKTIMLRRTKGTLLDGEPIINIPPKSILLMKVDFSIEERDFYNKLEADS 361 + HGYKKLQAVL+ IMLRRTKGTLLDG+PIIN+PPK+I L+KVDFS+EER FY KLE+DS Sbjct: 546 SLHGYKKLQAVLRAIMLRRTKGTLLDGQPIINLPPKTINLIKVDFSVEERSFYMKLESDS 605 Query: 362 RSQFKEYAAA 391 RSQFK YAAA Sbjct: 606 RSQFKAYAAA 615 >ref|XP_002267403.2| PREDICTED: uncharacterized ATP-dependent helicase C23E6.02-like [Vitis vinifera] Length = 1013 Score = 221 bits (564), Expect = 4e-56 Identities = 107/130 (82%), Positives = 118/130 (90%) Frame = +2 Query: 2 RTQVARACCGLRAKRRWCLSGTPIQNSIDDLFSYFRFLKYDPYAVFGAFCIAIKLPISRN 181 RTQVARACC LRAKRRWCLSGTPIQN+IDDL+SYFRFLKYDPYAV+ +F IK+PISRN Sbjct: 538 RTQVARACCSLRAKRRWCLSGTPIQNAIDDLYSYFRFLKYDPYAVYKSFYNTIKVPISRN 597 Query: 182 ASHGYKKLQAVLKTIMLRRTKGTLLDGEPIINIPPKSILLMKVDFSIEERDFYNKLEADS 361 + HGYKKLQAVL+ IMLRRTKGTL+DG PIIN+PPK+I L KVDFS EER FY+KLEADS Sbjct: 598 SVHGYKKLQAVLRAIMLRRTKGTLIDGTPIINLPPKTICLSKVDFSSEERAFYSKLEADS 657 Query: 362 RSQFKEYAAA 391 RSQFKEYAAA Sbjct: 658 RSQFKEYAAA 667 >emb|CBI35366.3| unnamed protein product [Vitis vinifera] Length = 907 Score = 221 bits (564), Expect = 4e-56 Identities = 107/130 (82%), Positives = 118/130 (90%) Frame = +2 Query: 2 RTQVARACCGLRAKRRWCLSGTPIQNSIDDLFSYFRFLKYDPYAVFGAFCIAIKLPISRN 181 RTQVARACC LRAKRRWCLSGTPIQN+IDDL+SYFRFLKYDPYAV+ +F IK+PISRN Sbjct: 450 RTQVARACCSLRAKRRWCLSGTPIQNAIDDLYSYFRFLKYDPYAVYKSFYNTIKVPISRN 509 Query: 182 ASHGYKKLQAVLKTIMLRRTKGTLLDGEPIINIPPKSILLMKVDFSIEERDFYNKLEADS 361 + HGYKKLQAVL+ IMLRRTKGTL+DG PIIN+PPK+I L KVDFS EER FY+KLEADS Sbjct: 510 SVHGYKKLQAVLRAIMLRRTKGTLIDGTPIINLPPKTICLSKVDFSSEERAFYSKLEADS 569 Query: 362 RSQFKEYAAA 391 RSQFKEYAAA Sbjct: 570 RSQFKEYAAA 579 >gb|AAF87890.1|AC012561_23 Similar tp transcription factors [Arabidopsis thaliana] Length = 1062 Score = 220 bits (560), Expect = 1e-55 Identities = 106/130 (81%), Positives = 118/130 (90%) Frame = +2 Query: 2 RTQVARACCGLRAKRRWCLSGTPIQNSIDDLFSYFRFLKYDPYAVFGAFCIAIKLPISRN 181 RTQVARACCGLRAKRRWCLSGTPIQN+IDDL+SYFRFLKYDPYAV+ +FC IK PISRN Sbjct: 567 RTQVARACCGLRAKRRWCLSGTPIQNTIDDLYSYFRFLKYDPYAVYKSFCHQIKGPISRN 626 Query: 182 ASHGYKKLQAVLKTIMLRRTKGTLLDGEPIINIPPKSILLMKVDFSIEERDFYNKLEADS 361 + GYKKLQAVL+ IMLRRTKGTLLDG+PIIN+PPK+I L +VDFS+EER FY KLE+DS Sbjct: 627 SLQGYKKLQAVLRAIMLRRTKGTLLDGQPIINLPPKTINLSQVDFSVEERSFYVKLESDS 686 Query: 362 RSQFKEYAAA 391 RSQFK YAAA Sbjct: 687 RSQFKAYAAA 696 >ref|NP_564568.1| SNF2 and helicase domain-containing protein [Arabidopsis thaliana] gi|14532630|gb|AAK64043.1| putative DNA-binding protein [Arabidopsis thaliana] gi|23296945|gb|AAN13207.1| putative DNA-binding protein [Arabidopsis thaliana] gi|332194424|gb|AEE32545.1| SNF2 and helicase domain-containing protein [Arabidopsis thaliana] Length = 981 Score = 220 bits (560), Expect = 1e-55 Identities = 106/130 (81%), Positives = 118/130 (90%) Frame = +2 Query: 2 RTQVARACCGLRAKRRWCLSGTPIQNSIDDLFSYFRFLKYDPYAVFGAFCIAIKLPISRN 181 RTQVARACCGLRAKRRWCLSGTPIQN+IDDL+SYFRFLKYDPYAV+ +FC IK PISRN Sbjct: 486 RTQVARACCGLRAKRRWCLSGTPIQNTIDDLYSYFRFLKYDPYAVYKSFCHQIKGPISRN 545 Query: 182 ASHGYKKLQAVLKTIMLRRTKGTLLDGEPIINIPPKSILLMKVDFSIEERDFYNKLEADS 361 + GYKKLQAVL+ IMLRRTKGTLLDG+PIIN+PPK+I L +VDFS+EER FY KLE+DS Sbjct: 546 SLQGYKKLQAVLRAIMLRRTKGTLLDGQPIINLPPKTINLSQVDFSVEERSFYVKLESDS 605 Query: 362 RSQFKEYAAA 391 RSQFK YAAA Sbjct: 606 RSQFKAYAAA 615