BLASTX nr result
ID: Coptis24_contig00014236
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00014236 (700 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002284754.1| PREDICTED: protein SYS1 homolog [Vitis vinif... 93 6e-17 ref|XP_002528192.1| conserved hypothetical protein [Ricinus comm... 86 5e-15 gb|AFK43804.1| unknown [Lotus japonicus] 86 7e-15 ref|XP_004141851.1| PREDICTED: protein SYS1 homolog [Cucumis sat... 84 3e-14 ref|XP_002304184.1| predicted protein [Populus trichocarpa] gi|2... 83 5e-14 >ref|XP_002284754.1| PREDICTED: protein SYS1 homolog [Vitis vinifera] gi|297743295|emb|CBI36162.3| unnamed protein product [Vitis vinifera] Length = 152 Score = 92.8 bits (229), Expect = 6e-17 Identities = 41/45 (91%), Positives = 44/45 (97%) Frame = +2 Query: 2 GGWPSTITWWVVNGTCLAVMALLGEWLCIRRELREIPITRYRSNV 136 GGWPS+ITWWVVNGTCLA+MALLGE+LCIRREL EIPITRYRSNV Sbjct: 108 GGWPSSITWWVVNGTCLAMMALLGEYLCIRRELLEIPITRYRSNV 152 >ref|XP_002528192.1| conserved hypothetical protein [Ricinus communis] gi|223532404|gb|EEF34199.1| conserved hypothetical protein [Ricinus communis] Length = 143 Score = 86.3 bits (212), Expect = 5e-15 Identities = 38/45 (84%), Positives = 43/45 (95%) Frame = +2 Query: 2 GGWPSTITWWVVNGTCLAVMALLGEWLCIRRELREIPITRYRSNV 136 GGWPS++TWWVV+GT LAVMALLGE+LCIRREL+EIPITRYRS V Sbjct: 66 GGWPSSVTWWVVSGTGLAVMALLGEYLCIRRELKEIPITRYRSRV 110 >gb|AFK43804.1| unknown [Lotus japonicus] Length = 152 Score = 85.9 bits (211), Expect = 7e-15 Identities = 38/45 (84%), Positives = 42/45 (93%) Frame = +2 Query: 2 GGWPSTITWWVVNGTCLAVMALLGEWLCIRRELREIPITRYRSNV 136 GGWPS ITWW+VNGT +AVMALLGE+LCIRREL+EIPITR RSNV Sbjct: 108 GGWPSAITWWIVNGTGIAVMALLGEYLCIRRELQEIPITRLRSNV 152 >ref|XP_004141851.1| PREDICTED: protein SYS1 homolog [Cucumis sativus] gi|449522538|ref|XP_004168283.1| PREDICTED: protein SYS1 homolog [Cucumis sativus] Length = 151 Score = 84.0 bits (206), Expect = 3e-14 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = +2 Query: 2 GGWPSTITWWVVNGTCLAVMALLGEWLCIRRELREIPITRYRSNV 136 GGWPS++TWWVVNGT L VM+LLGE+LCI+RELREIPITR RSNV Sbjct: 107 GGWPSSMTWWVVNGTGLVVMSLLGEYLCIKRELREIPITRLRSNV 151 >ref|XP_002304184.1| predicted protein [Populus trichocarpa] gi|222841616|gb|EEE79163.1| predicted protein [Populus trichocarpa] Length = 151 Score = 83.2 bits (204), Expect = 5e-14 Identities = 39/45 (86%), Positives = 42/45 (93%) Frame = +2 Query: 2 GGWPSTITWWVVNGTCLAVMALLGEWLCIRRELREIPITRYRSNV 136 GGWPS+ITWWVVNGT AVMALLGE+LCI+RELREIP TRYRSNV Sbjct: 108 GGWPSSITWWVVNGTGFAVMALLGEYLCIKRELREIP-TRYRSNV 151