BLASTX nr result
ID: Coptis24_contig00014183
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00014183 (485 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADY68770.1| DREB1/CBF transcription factor [Adonis amurensis] 67 2e-09 ref|XP_003539462.1| PREDICTED: dehydration-responsive element-bi... 60 2e-07 emb|CBI17075.3| unnamed protein product [Vitis vinifera] 60 2e-07 ref|XP_002270637.1| PREDICTED: dehydration-responsive element-bi... 60 2e-07 gb|AAR28674.1| CBF-like transcription factor [Vitis riparia] 59 5e-07 >gb|ADY68770.1| DREB1/CBF transcription factor [Adonis amurensis] Length = 206 Score = 66.6 bits (161), Expect = 2e-09 Identities = 32/48 (66%), Positives = 37/48 (77%), Gaps = 4/48 (8%) Frame = -3 Query: 267 FWDEEAMMDMPSLLDSMAEGLLLPPPRMHEKFDWVDVD----LSLWSD 136 FWDEEAM +MPSLLD+MAEG+LL PP M E+F DVD LSLW+D Sbjct: 159 FWDEEAMFNMPSLLDNMAEGMLLTPPSMQERFSCEDVDFNMELSLWND 206 >ref|XP_003539462.1| PREDICTED: dehydration-responsive element-binding protein 1F-like [Glycine max] Length = 252 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/48 (58%), Positives = 35/48 (72%), Gaps = 4/48 (8%) Frame = -3 Query: 267 FWDEEAMMDMPSLLDSMAEGLLLPPPRMHEKFDW----VDVDLSLWSD 136 F+DEEA +MP LLDSMAEGLL+ PP M FDW ++DL+LW+D Sbjct: 205 FFDEEAFYNMPLLLDSMAEGLLITPPSMKRVFDWDQVDCEIDLTLWTD 252 >emb|CBI17075.3| unnamed protein product [Vitis vinifera] Length = 265 Score = 60.1 bits (144), Expect = 2e-07 Identities = 30/47 (63%), Positives = 34/47 (72%), Gaps = 4/47 (8%) Frame = -3 Query: 267 FWDEEAMMDMPSLLDSMAEGLLLPPPRMHEKFDWVD----VDLSLWS 139 F DEEAM +MP L+DSMAEGLLL PP M E F W D +DLSLW+ Sbjct: 169 FVDEEAMFNMPGLIDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWN 215 >ref|XP_002270637.1| PREDICTED: dehydration-responsive element-binding protein 1D-like [Vitis vinifera] Length = 253 Score = 60.1 bits (144), Expect = 2e-07 Identities = 30/47 (63%), Positives = 34/47 (72%), Gaps = 4/47 (8%) Frame = -3 Query: 267 FWDEEAMMDMPSLLDSMAEGLLLPPPRMHEKFDWVD----VDLSLWS 139 F DEEAM +MP L+DSMAEGLLL PP M E F W D +DLSLW+ Sbjct: 202 FVDEEAMFNMPGLIDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWN 248 >gb|AAR28674.1| CBF-like transcription factor [Vitis riparia] Length = 250 Score = 58.5 bits (140), Expect = 5e-07 Identities = 29/47 (61%), Positives = 34/47 (72%), Gaps = 4/47 (8%) Frame = -3 Query: 267 FWDEEAMMDMPSLLDSMAEGLLLPPPRMHEKFDWVD----VDLSLWS 139 F DEEA+ +MP L+DSMAEGLLL PP M E F W D +DLSLW+ Sbjct: 199 FVDEEAVFNMPGLIDSMAEGLLLTPPAMCEGFSWDDAVSHIDLSLWN 245