BLASTX nr result
ID: Coptis24_contig00013798
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00013798 (203 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002282506.1| PREDICTED: ubiquitin-associated domain-conta... 100 9e-20 ref|XP_002307981.1| predicted protein [Populus trichocarpa] gi|2... 99 3e-19 ref|XP_004168697.1| PREDICTED: uncharacterized protein LOC101228... 93 2e-17 ref|XP_004141121.1| PREDICTED: ubiquitin-associated domain-conta... 93 2e-17 ref|NP_191233.1| Ubiquitin-associated (UBA) protein [Arabidopsis... 93 2e-17 >ref|XP_002282506.1| PREDICTED: ubiquitin-associated domain-containing protein 2 isoform 1 [Vitis vinifera] gi|297741648|emb|CBI32780.3| unnamed protein product [Vitis vinifera] Length = 294 Score = 100 bits (250), Expect = 9e-20 Identities = 47/67 (70%), Positives = 54/67 (80%) Frame = +1 Query: 1 SSWKRSILPGICGVLAGLLYRSNIFGIRRIKFPEFVSSLFSRLSWPTLGGSSPSASSGNV 180 SSWKRSILPGICG+LAG LYR N F IR++KFPEF+SS FSRLS P G SS +A S N+ Sbjct: 166 SSWKRSILPGICGILAGSLYRLNFFHIRKMKFPEFISSFFSRLSSPATGSSSTAAPSRNI 225 Query: 181 IGNTPSY 201 +GN PSY Sbjct: 226 LGNAPSY 232 >ref|XP_002307981.1| predicted protein [Populus trichocarpa] gi|222853957|gb|EEE91504.1| predicted protein [Populus trichocarpa] Length = 290 Score = 99.4 bits (246), Expect = 3e-19 Identities = 47/67 (70%), Positives = 55/67 (82%) Frame = +1 Query: 1 SSWKRSILPGICGVLAGLLYRSNIFGIRRIKFPEFVSSLFSRLSWPTLGGSSPSASSGNV 180 SSWKRSILPGICG+LAG LYR N+FGIR+ KFPEF++S FSRLSWP+ GS A+S NV Sbjct: 166 SSWKRSILPGICGILAGSLYRLNLFGIRKAKFPEFIASFFSRLSWPST-GSPRGATSRNV 224 Query: 181 IGNTPSY 201 G+ PSY Sbjct: 225 TGSAPSY 231 >ref|XP_004168697.1| PREDICTED: uncharacterized protein LOC101228515 [Cucumis sativus] Length = 291 Score = 93.2 bits (230), Expect = 2e-17 Identities = 44/67 (65%), Positives = 55/67 (82%) Frame = +1 Query: 1 SSWKRSILPGICGVLAGLLYRSNIFGIRRIKFPEFVSSLFSRLSWPTLGGSSPSASSGNV 180 SSW+RSILPGICG+LAG LYR N+FGIR+ KFPEF+SS FSRLS P+ G+ P+A + +V Sbjct: 166 SSWRRSILPGICGILAGSLYRLNVFGIRKAKFPEFISSFFSRLSLPS-AGNPPAAPNRDV 224 Query: 181 IGNTPSY 201 GN PS+ Sbjct: 225 RGNMPSF 231 >ref|XP_004141121.1| PREDICTED: ubiquitin-associated domain-containing protein 2-like [Cucumis sativus] Length = 291 Score = 93.2 bits (230), Expect = 2e-17 Identities = 44/67 (65%), Positives = 55/67 (82%) Frame = +1 Query: 1 SSWKRSILPGICGVLAGLLYRSNIFGIRRIKFPEFVSSLFSRLSWPTLGGSSPSASSGNV 180 SSW+RSILPGICG+LAG LYR N+FGIR+ KFPEF+SS FSRLS P+ G+ P+A + +V Sbjct: 166 SSWRRSILPGICGILAGSLYRLNVFGIRKAKFPEFISSFFSRLSLPS-AGNPPAAPNRDV 224 Query: 181 IGNTPSY 201 GN PS+ Sbjct: 225 RGNMPSF 231 >ref|NP_191233.1| Ubiquitin-associated (UBA) protein [Arabidopsis thaliana] gi|9662993|emb|CAC00737.1| putative protein [Arabidopsis thaliana] gi|21553945|gb|AAM63026.1| unknown [Arabidopsis thaliana] gi|28950711|gb|AAO63279.1| At3g56740 [Arabidopsis thaliana] gi|110735889|dbj|BAE99920.1| hypothetical protein [Arabidopsis thaliana] gi|332646039|gb|AEE79560.1| Ubiquitin-associated (UBA) protein [Arabidopsis thaliana] Length = 293 Score = 93.2 bits (230), Expect = 2e-17 Identities = 42/62 (67%), Positives = 50/62 (80%) Frame = +1 Query: 1 SSWKRSILPGICGVLAGLLYRSNIFGIRRIKFPEFVSSLFSRLSWPTLGGSSPSASSGNV 180 SSWKRSI PGICG++AG LYR NI GIR+ KFPEFV+S FSRLS+P+ G S P A S N+ Sbjct: 166 SSWKRSIFPGICGIIAGSLYRLNILGIRKAKFPEFVASFFSRLSFPSFGNSPPPAPSRNI 225 Query: 181 IG 186 +G Sbjct: 226 VG 227