BLASTX nr result
ID: Coptis24_contig00013758
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00013758 (633 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002263940.1| PREDICTED: uncharacterized protein LOC100267... 108 8e-22 ref|XP_004134854.1| PREDICTED: uncharacterized protein LOC101220... 104 2e-20 ref|XP_002327654.1| predicted protein [Populus trichocarpa] gi|2... 102 8e-20 ref|XP_002529645.1| conserved hypothetical protein [Ricinus comm... 101 1e-19 dbj|BAJ85042.1| predicted protein [Hordeum vulgare subsp. vulgare] 99 5e-19 >ref|XP_002263940.1| PREDICTED: uncharacterized protein LOC100267639 [Vitis vinifera] gi|297734986|emb|CBI17348.3| unnamed protein product [Vitis vinifera] Length = 95 Score = 108 bits (270), Expect = 8e-22 Identities = 51/67 (76%), Positives = 59/67 (88%) Frame = +3 Query: 33 EDYEIEEKKQAAADVLYQYSQFVMVSIGERVRPCDLRLHLMKEISGMPTSLKGATSKAGA 212 +DYE+EEKKQAAADVL+QYS+FVM IG +VRPCDLRLHLMKEISGMPTSLK +S+ A Sbjct: 3 DDYEVEEKKQAAADVLFQYSKFVMACIGNQVRPCDLRLHLMKEISGMPTSLKRESSQTAA 62 Query: 213 SPDVVGE 233 SPD +GE Sbjct: 63 SPDAMGE 69 >ref|XP_004134854.1| PREDICTED: uncharacterized protein LOC101220806 [Cucumis sativus] gi|449491322|ref|XP_004158861.1| PREDICTED: uncharacterized LOC101220806 isoform 2 [Cucumis sativus] Length = 87 Score = 104 bits (259), Expect = 2e-20 Identities = 49/67 (73%), Positives = 57/67 (85%) Frame = +3 Query: 33 EDYEIEEKKQAAADVLYQYSQFVMVSIGERVRPCDLRLHLMKEISGMPTSLKGATSKAGA 212 +DYE EEKKQAAADV++QYS+FVM IG +VRPCDLR HLMKEISGMPTSLK +S+ A Sbjct: 3 DDYETEEKKQAAADVMFQYSKFVMACIGNQVRPCDLRFHLMKEISGMPTSLKRESSQRAA 62 Query: 213 SPDVVGE 233 SPD +GE Sbjct: 63 SPDAMGE 69 >ref|XP_002327654.1| predicted protein [Populus trichocarpa] gi|222836739|gb|EEE75132.1| predicted protein [Populus trichocarpa] Length = 87 Score = 102 bits (253), Expect = 8e-20 Identities = 50/67 (74%), Positives = 56/67 (83%) Frame = +3 Query: 33 EDYEIEEKKQAAADVLYQYSQFVMVSIGERVRPCDLRLHLMKEISGMPTSLKGATSKAGA 212 EDYEIEEKKQAAADVL+QYS+FVM IG +VRP LRLHLMKEISG+PTSLK +S A Sbjct: 3 EDYEIEEKKQAAADVLFQYSKFVMACIGNQVRPAGLRLHLMKEISGLPTSLKRESSHVAA 62 Query: 213 SPDVVGE 233 SPD +GE Sbjct: 63 SPDAMGE 69 >ref|XP_002529645.1| conserved hypothetical protein [Ricinus communis] gi|223530871|gb|EEF32732.1| conserved hypothetical protein [Ricinus communis] Length = 87 Score = 101 bits (252), Expect = 1e-19 Identities = 48/67 (71%), Positives = 54/67 (80%) Frame = +3 Query: 33 EDYEIEEKKQAAADVLYQYSQFVMVSIGERVRPCDLRLHLMKEISGMPTSLKGATSKAGA 212 EDYEIEEKKQAAADV++QYS+F M IG +VRPCDLR HLMKEISG PTSLK + A Sbjct: 3 EDYEIEEKKQAAADVMFQYSKFAMACIGNQVRPCDLRFHLMKEISGQPTSLKRELPQTAA 62 Query: 213 SPDVVGE 233 SPD +GE Sbjct: 63 SPDAMGE 69 >dbj|BAJ85042.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 93 Score = 99.4 bits (246), Expect = 5e-19 Identities = 50/68 (73%), Positives = 55/68 (80%) Frame = +3 Query: 33 EDYEIEEKKQAAADVLYQYSQFVMVSIGERVRPCDLRLHLMKEISGMPTSLKGATSKAGA 212 +DYE ++KKQAAADVL+ YSQFVMV IGE VRP DLRLHLMKEISGM TSLK +A A Sbjct: 12 DDYETQQKKQAAADVLFNYSQFVMVCIGEGVRPTDLRLHLMKEISGMATSLKEEPRQAAA 71 Query: 213 SPDVVGEP 236 SPD GEP Sbjct: 72 SPDSSGEP 79