BLASTX nr result
ID: Coptis24_contig00013730
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00013730 (515 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513517.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 >ref|XP_002513517.1| conserved hypothetical protein [Ricinus communis] gi|223547425|gb|EEF48920.1| conserved hypothetical protein [Ricinus communis] Length = 450 Score = 56.6 bits (135), Expect = 2e-06 Identities = 23/41 (56%), Positives = 32/41 (78%) Frame = -2 Query: 511 YISLPDGDLYSPKVPDMVTYKGQRFTFAANQKKESSKVVPG 389 YI+LPDG LY+PK P +V YKGQR+ AA+ K++ K++PG Sbjct: 323 YINLPDGSLYAPKPPHLVWYKGQRYVCAADSKEDPPKIIPG 363