BLASTX nr result
ID: Coptis24_contig00013559
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00013559 (263 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCI55413.1| PH01B015M02.14 [Phyllostachys edulis] 66 3e-09 ref|XP_002974464.1| hypothetical protein SELMODRAFT_442455 [Sela... 66 3e-09 ref|XP_002466221.1| hypothetical protein SORBIDRAFT_01g003790 [S... 66 3e-09 ref|NP_001168609.1| uncharacterized protein LOC100382393 [Zea ma... 66 3e-09 ref|XP_002530840.1| Pre-mRNA branch site protein p14, putative [... 66 3e-09 >emb|CCI55413.1| PH01B015M02.14 [Phyllostachys edulis] Length = 130 Score = 65.9 bits (159), Expect = 3e-09 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 111 NSAMTPEVNRVSYVRNLPFNISSE*MYDIFGKYGAIR 1 N+ + PEVNRV YVRNLPFNISSE MYDIFGKYGAIR Sbjct: 10 NARLPPEVNRVLYVRNLPFNISSEEMYDIFGKYGAIR 46 >ref|XP_002974464.1| hypothetical protein SELMODRAFT_442455 [Selaginella moellendorffii] gi|302818419|ref|XP_002990883.1| hypothetical protein SELMODRAFT_229573 [Selaginella moellendorffii] gi|300141444|gb|EFJ08156.1| hypothetical protein SELMODRAFT_229573 [Selaginella moellendorffii] gi|300158062|gb|EFJ24686.1| hypothetical protein SELMODRAFT_442455 [Selaginella moellendorffii] Length = 120 Score = 65.9 bits (159), Expect = 3e-09 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 111 NSAMTPEVNRVSYVRNLPFNISSE*MYDIFGKYGAIR 1 N+ + PEVNRV YVRNLPFNISSE MYDIFGKYGAIR Sbjct: 9 NTRLPPEVNRVLYVRNLPFNISSEEMYDIFGKYGAIR 45 >ref|XP_002466221.1| hypothetical protein SORBIDRAFT_01g003790 [Sorghum bicolor] gi|241920075|gb|EER93219.1| hypothetical protein SORBIDRAFT_01g003790 [Sorghum bicolor] Length = 130 Score = 65.9 bits (159), Expect = 3e-09 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 111 NSAMTPEVNRVSYVRNLPFNISSE*MYDIFGKYGAIR 1 N+ + PEVNRV YVRNLPFNISSE MYDIFGKYGAIR Sbjct: 10 NARLPPEVNRVLYVRNLPFNISSEEMYDIFGKYGAIR 46 >ref|NP_001168609.1| uncharacterized protein LOC100382393 [Zea mays] gi|223949529|gb|ACN28848.1| unknown [Zea mays] gi|413932679|gb|AFW67230.1| hypothetical protein ZEAMMB73_938561 [Zea mays] Length = 130 Score = 65.9 bits (159), Expect = 3e-09 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 111 NSAMTPEVNRVSYVRNLPFNISSE*MYDIFGKYGAIR 1 N+ + PEVNRV YVRNLPFNISSE MYDIFGKYGAIR Sbjct: 10 NARLPPEVNRVLYVRNLPFNISSEEMYDIFGKYGAIR 46 >ref|XP_002530840.1| Pre-mRNA branch site protein p14, putative [Ricinus communis] gi|223529604|gb|EEF31553.1| Pre-mRNA branch site protein p14, putative [Ricinus communis] Length = 124 Score = 65.9 bits (159), Expect = 3e-09 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 111 NSAMTPEVNRVSYVRNLPFNISSE*MYDIFGKYGAIR 1 N+ + PEVNRV YVRNLPFNISSE MYDIFGKYGAIR Sbjct: 10 NTRLPPEVNRVLYVRNLPFNISSEEMYDIFGKYGAIR 46