BLASTX nr result
ID: Coptis24_contig00013257
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00013257 (247 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510077.1| serine carboxypeptidase, putative [Ricinus c... 72 5e-11 emb|CBI19380.3| unnamed protein product [Vitis vinifera] 71 1e-10 ref|XP_002283413.1| PREDICTED: serine carboxypeptidase-like 2-li... 71 1e-10 gb|AAK52316.1| sinapoylglucose:choline sinapoyltransferase [Arab... 69 3e-10 ref|NP_568215.2| sinapoylglucose-choline O-sinapoyltransferase [... 69 3e-10 >ref|XP_002510077.1| serine carboxypeptidase, putative [Ricinus communis] gi|223550778|gb|EEF52264.1| serine carboxypeptidase, putative [Ricinus communis] Length = 468 Score = 72.0 bits (175), Expect = 5e-11 Identities = 32/44 (72%), Positives = 38/44 (86%) Frame = +2 Query: 116 ALSYSTVTSLPGFKGSLPFQLETGYVGVGESGDVQMFYYFVKSE 247 A+SYST+ LPGF+G LPF LETGY+GV ES DVQ+FYYFVKS+ Sbjct: 24 AVSYSTIKYLPGFQGPLPFSLETGYIGVDESEDVQLFYYFVKSQ 67 >emb|CBI19380.3| unnamed protein product [Vitis vinifera] Length = 503 Score = 70.9 bits (172), Expect = 1e-10 Identities = 33/44 (75%), Positives = 38/44 (86%) Frame = +2 Query: 116 ALSYSTVTSLPGFKGSLPFQLETGYVGVGESGDVQMFYYFVKSE 247 A S+S V LPGF+G LPF+LETGYVGVGES +VQ+FYYFVKSE Sbjct: 59 AASHSPVKFLPGFEGPLPFELETGYVGVGESEEVQLFYYFVKSE 102 >ref|XP_002283413.1| PREDICTED: serine carboxypeptidase-like 2-like [Vitis vinifera] Length = 469 Score = 70.9 bits (172), Expect = 1e-10 Identities = 33/44 (75%), Positives = 38/44 (86%) Frame = +2 Query: 116 ALSYSTVTSLPGFKGSLPFQLETGYVGVGESGDVQMFYYFVKSE 247 A S+S V LPGF+G LPF+LETGYVGVGES +VQ+FYYFVKSE Sbjct: 25 AASHSPVKFLPGFEGPLPFELETGYVGVGESEEVQLFYYFVKSE 68 >gb|AAK52316.1| sinapoylglucose:choline sinapoyltransferase [Arabidopsis thaliana] Length = 464 Score = 69.3 bits (168), Expect = 3e-10 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = +2 Query: 134 VTSLPGFKGSLPFQLETGYVGVGESGDVQMFYYFVKSE 247 V SLPGF+G LPF+LETGYV +GESGDV++FYYFVKSE Sbjct: 27 VKSLPGFEGPLPFELETGYVSIGESGDVELFYYFVKSE 64 >ref|NP_568215.2| sinapoylglucose-choline O-sinapoyltransferase [Arabidopsis thaliana] gi|75161701|sp|Q8VZU3.1|SCP19_ARATH RecName: Full=Serine carboxypeptidase-like 19; AltName: Full=Protein SINAPOYLGLUCOSE ACCUMULATOR 2; AltName: Full=Sinapoylglucose--choline O-sinapoyltransferase; Short=SCT; Contains: RecName: Full=Serine carboxypeptidase-like 19 chain A; Contains: RecName: Full=Serine carboxypeptidase-like 19 chain B; Flags: Precursor gi|17380718|gb|AAL36189.1| putative carboxypeptidase [Arabidopsis thaliana] gi|20259065|gb|AAM14248.1| putative carboxypeptidase [Arabidopsis thaliana] gi|332004037|gb|AED91420.1| sinapoylglucose-choline O-sinapoyltransferase [Arabidopsis thaliana] Length = 465 Score = 69.3 bits (168), Expect = 3e-10 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = +2 Query: 134 VTSLPGFKGSLPFQLETGYVGVGESGDVQMFYYFVKSE 247 V SLPGF+G LPF+LETGYV +GESGDV++FYYFVKSE Sbjct: 27 VKSLPGFEGPLPFELETGYVSIGESGDVELFYYFVKSE 64