BLASTX nr result
ID: Coptis24_contig00013180
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00013180 (227 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002272288.2| PREDICTED: uncharacterized protein LOC100251... 96 4e-18 ref|XP_004171954.1| PREDICTED: uncharacterized LOC101217173 [Cuc... 91 1e-16 ref|XP_004134585.1| PREDICTED: uncharacterized protein LOC101217... 91 1e-16 ref|XP_002531051.1| conserved hypothetical protein [Ricinus comm... 89 5e-16 gb|AFK42676.1| unknown [Medicago truncatula] 88 6e-16 >ref|XP_002272288.2| PREDICTED: uncharacterized protein LOC100251522 [Vitis vinifera] gi|297740769|emb|CBI30951.3| unnamed protein product [Vitis vinifera] Length = 512 Score = 95.5 bits (236), Expect = 4e-18 Identities = 45/61 (73%), Positives = 56/61 (91%) Frame = -1 Query: 227 EVEGEDEAYEKLSRNWSVLKSTPELQKSKGKPKKEGPISLDDAIADSESLTDFLLDFNED 48 EVEG+DE EK++RNWSVLKSTP+L+KSK KPKKEGP+S+++A+ DSE+LTDFLLDF ED Sbjct: 453 EVEGDDEE-EKITRNWSVLKSTPQLRKSKDKPKKEGPMSVEEAVDDSENLTDFLLDFEED 511 Query: 47 E 45 E Sbjct: 512 E 512 >ref|XP_004171954.1| PREDICTED: uncharacterized LOC101217173 [Cucumis sativus] Length = 502 Score = 90.9 bits (224), Expect = 1e-16 Identities = 42/61 (68%), Positives = 51/61 (83%) Frame = -1 Query: 227 EVEGEDEAYEKLSRNWSVLKSTPELQKSKGKPKKEGPISLDDAIADSESLTDFLLDFNED 48 EVEG++EA EK++RNWSVLKS+P L K KGKP K+ P SLD AI +SE+LTDFL+DF ED Sbjct: 442 EVEGDEEAEEKITRNWSVLKSSPHLSKQKGKPNKKDPASLDGAIDESENLTDFLMDFEED 501 Query: 47 E 45 E Sbjct: 502 E 502 >ref|XP_004134585.1| PREDICTED: uncharacterized protein LOC101217173 [Cucumis sativus] Length = 527 Score = 90.9 bits (224), Expect = 1e-16 Identities = 42/61 (68%), Positives = 51/61 (83%) Frame = -1 Query: 227 EVEGEDEAYEKLSRNWSVLKSTPELQKSKGKPKKEGPISLDDAIADSESLTDFLLDFNED 48 EVEG++EA EK++RNWSVLKS+P L K KGKP K+ P SLD AI +SE+LTDFL+DF ED Sbjct: 467 EVEGDEEAEEKITRNWSVLKSSPHLSKQKGKPNKKDPASLDGAIDESENLTDFLMDFEED 526 Query: 47 E 45 E Sbjct: 527 E 527 >ref|XP_002531051.1| conserved hypothetical protein [Ricinus communis] gi|223529346|gb|EEF31312.1| conserved hypothetical protein [Ricinus communis] Length = 524 Score = 88.6 bits (218), Expect = 5e-16 Identities = 41/61 (67%), Positives = 53/61 (86%) Frame = -1 Query: 227 EVEGEDEAYEKLSRNWSVLKSTPELQKSKGKPKKEGPISLDDAIADSESLTDFLLDFNED 48 E E E+E EK++RNWSVLKSTP+L+KSK KPKK+G +SL++AI DSE+LTDFL+DF E+ Sbjct: 463 EEEEEEEEEEKVTRNWSVLKSTPQLRKSKAKPKKDGGMSLEEAIEDSENLTDFLMDFGEE 522 Query: 47 E 45 E Sbjct: 523 E 523 >gb|AFK42676.1| unknown [Medicago truncatula] Length = 101 Score = 88.2 bits (217), Expect = 6e-16 Identities = 41/61 (67%), Positives = 53/61 (86%), Gaps = 1/61 (1%) Frame = -1 Query: 227 EVEGEDEAYE-KLSRNWSVLKSTPELQKSKGKPKKEGPISLDDAIADSESLTDFLLDFNE 51 E EG++E E K+ RNWSVLK+TP+L+KSK KPKKEGP++LD+A+ DSE+LTDFLLDF E Sbjct: 41 EAEGDEEEDESKIDRNWSVLKTTPQLRKSKPKPKKEGPMTLDEAVGDSENLTDFLLDFEE 100 Query: 50 D 48 + Sbjct: 101 E 101