BLASTX nr result
ID: Coptis24_contig00013141
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00013141 (547 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513136.1| serine-threonine protein kinase, plant-type,... 45 7e-06 >ref|XP_002513136.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223548147|gb|EEF49639.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Length = 592 Score = 45.1 bits (105), Expect(2) = 7e-06 Identities = 20/36 (55%), Positives = 26/36 (72%) Frame = -3 Query: 194 SLFGDSLLRHASFKANKLYGLIPNVSPFNIFPVSAY 87 +L G L+HA+F+AN+L G IP P+NIFP SAY Sbjct: 534 TLLGIKSLKHANFRANRLCGEIPQRRPYNIFPASAY 569 Score = 29.6 bits (65), Expect(2) = 7e-06 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -1 Query: 85 HDQCLCGKPMSTFRGR 38 H+QCLCGKP+ RG+ Sbjct: 571 HNQCLCGKPLPPCRGK 586