BLASTX nr result
ID: Coptis24_contig00013103
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00013103 (760 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520370.1| glyoxalase II, putative [Ricinus communis] g... 83 7e-14 ref|XP_002307560.1| predicted protein [Populus trichocarpa] gi|2... 78 2e-12 gb|ADK13088.1| hydroxyacylglutathione hydrolase [Knorringia sibi... 77 4e-12 emb|CBI22090.3| unnamed protein product [Vitis vinifera] 76 7e-12 ref|XP_002279121.1| PREDICTED: hydroxyacylglutathione hydrolase ... 76 7e-12 >ref|XP_002520370.1| glyoxalase II, putative [Ricinus communis] gi|223540417|gb|EEF41986.1| glyoxalase II, putative [Ricinus communis] Length = 301 Score = 82.8 bits (203), Expect = 7e-14 Identities = 38/48 (79%), Positives = 44/48 (91%) Frame = -3 Query: 758 RLTKDEDTFKSIMENLNLPYPKMIDVAVPANMVCGLQDVTKKSCEPLA 615 RLTKD++TFKSIMENLNLPYPKMID+AVPANMVCGLQD++ K E L+ Sbjct: 251 RLTKDQETFKSIMENLNLPYPKMIDIAVPANMVCGLQDLSVKPVEALS 298 >ref|XP_002307560.1| predicted protein [Populus trichocarpa] gi|222857009|gb|EEE94556.1| predicted protein [Populus trichocarpa] Length = 265 Score = 77.8 bits (190), Expect = 2e-12 Identities = 35/42 (83%), Positives = 40/42 (95%) Frame = -3 Query: 758 RLTKDEDTFKSIMENLNLPYPKMIDVAVPANMVCGLQDVTKK 633 RLTKDE+ FKSIMENLNLPYPKMID+AVP+NMVCGLQD++ K Sbjct: 217 RLTKDEEMFKSIMENLNLPYPKMIDIAVPSNMVCGLQDLSVK 258 >gb|ADK13088.1| hydroxyacylglutathione hydrolase [Knorringia sibirica] Length = 254 Score = 77.0 bits (188), Expect = 4e-12 Identities = 37/43 (86%), Positives = 38/43 (88%) Frame = -3 Query: 758 RLTKDEDTFKSIMENLNLPYPKMIDVAVPANMVCGLQDVTKKS 630 RLTKDE+ FKSIMENLNL YPKMIDVAVPANMVCGLQD KS Sbjct: 211 RLTKDEEAFKSIMENLNLAYPKMIDVAVPANMVCGLQDPVAKS 253 >emb|CBI22090.3| unnamed protein product [Vitis vinifera] Length = 258 Score = 76.3 bits (186), Expect = 7e-12 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = -3 Query: 758 RLTKDEDTFKSIMENLNLPYPKMIDVAVPANMVCGLQDVTKK 633 RLTKDE+TFK IMENLNL YPKMID+AVPANMVCGLQD++ K Sbjct: 215 RLTKDEETFKDIMENLNLSYPKMIDLAVPANMVCGLQDLSAK 256 >ref|XP_002279121.1| PREDICTED: hydroxyacylglutathione hydrolase 3, mitochondrial-like [Vitis vinifera] Length = 269 Score = 76.3 bits (186), Expect = 7e-12 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = -3 Query: 758 RLTKDEDTFKSIMENLNLPYPKMIDVAVPANMVCGLQDVTKK 633 RLTKDE+TFK IMENLNL YPKMID+AVPANMVCGLQD++ K Sbjct: 226 RLTKDEETFKDIMENLNLSYPKMIDLAVPANMVCGLQDLSAK 267