BLASTX nr result
ID: Coptis24_contig00012452
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00012452 (746 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002317723.1| predicted protein [Populus trichocarpa] gi|2... 74 3e-11 ref|XP_002530545.1| protein binding protein, putative [Ricinus c... 68 2e-09 ref|XP_002268131.1| PREDICTED: uncharacterized protein LOC100261... 64 4e-08 emb|CAN66246.1| hypothetical protein VITISV_033016 [Vitis vinifera] 64 4e-08 dbj|BAF80453.1| DC1 domain containing protein [Nicotiana tabacum] 58 2e-06 >ref|XP_002317723.1| predicted protein [Populus trichocarpa] gi|222858396|gb|EEE95943.1| predicted protein [Populus trichocarpa] Length = 326 Score = 73.9 bits (180), Expect = 3e-11 Identities = 29/45 (64%), Positives = 34/45 (75%) Frame = +1 Query: 1 SVKHQSHSHPLKLIYNPPYQTKGLSCDVCQKLGSK*WLYRCNVCE 135 S+ HQSH H L L + PPYQTKG SCD+C K+GS WLYRC+ CE Sbjct: 120 SLAHQSHPHQLNLAFYPPYQTKGFSCDICHKIGSNHWLYRCSACE 164 >ref|XP_002530545.1| protein binding protein, putative [Ricinus communis] gi|223529907|gb|EEF31836.1| protein binding protein, putative [Ricinus communis] Length = 324 Score = 67.8 bits (164), Expect = 2e-09 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = +1 Query: 1 SVKHQSHSHPLKLIYNPPYQTKGLSCDVCQKLGSK*WLYRCNVCE 135 S+ +Q H H L+L ++PPY TKG SCD+CQK+GS WLYRC CE Sbjct: 121 SLTNQFHPHLLQLTFDPPYHTKGFSCDICQKIGSNHWLYRCAPCE 165 >ref|XP_002268131.1| PREDICTED: uncharacterized protein LOC100261320 [Vitis vinifera] Length = 360 Score = 63.5 bits (153), Expect = 4e-08 Identities = 23/44 (52%), Positives = 32/44 (72%) Frame = +1 Query: 4 VKHQSHSHPLKLIYNPPYQTKGLSCDVCQKLGSK*WLYRCNVCE 135 + HQSH H L L ++PPY K SCD+C+++G+ WLYRC+ CE Sbjct: 126 LNHQSHHHRLALSFSPPYHNKSFSCDICRQIGTSHWLYRCDECE 169 >emb|CAN66246.1| hypothetical protein VITISV_033016 [Vitis vinifera] Length = 366 Score = 63.5 bits (153), Expect = 4e-08 Identities = 23/44 (52%), Positives = 32/44 (72%) Frame = +1 Query: 4 VKHQSHSHPLKLIYNPPYQTKGLSCDVCQKLGSK*WLYRCNVCE 135 + HQSH H L L ++PPY K SCD+C+++G+ WLYRC+ CE Sbjct: 132 LNHQSHHHRLALSFSPPYHNKSFSCDICRQIGTSHWLYRCDECE 175 >dbj|BAF80453.1| DC1 domain containing protein [Nicotiana tabacum] Length = 212 Score = 58.2 bits (139), Expect = 2e-06 Identities = 22/43 (51%), Positives = 28/43 (65%) Frame = +1 Query: 4 VKHQSHSHPLKLIYNPPYQTKGLSCDVCQKLGSK*WLYRCNVC 132 V H SH H L L ++PPY K CD+C+K+G+ WLYRC C Sbjct: 129 VTHWSHHHQLDLKFSPPYPGKSFCCDICKKVGTNHWLYRCQTC 171