BLASTX nr result
ID: Coptis24_contig00012376
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00012376 (1238 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACQ41893.1| cinnamoyl-CoA reductase [Camellia oleifera] 81 6e-13 ref|XP_002526627.1| cinnamoyl-CoA reductase, putative [Ricinus c... 77 7e-12 ref|XP_002526624.1| cinnamoyl-CoA reductase, putative [Ricinus c... 77 7e-12 ref|XP_002275195.1| PREDICTED: dihydroflavonol-4-reductase [Viti... 77 7e-12 emb|CAN76154.1| hypothetical protein VITISV_012676 [Vitis vinifera] 77 7e-12 >gb|ACQ41893.1| cinnamoyl-CoA reductase [Camellia oleifera] Length = 329 Score = 80.9 bits (198), Expect = 6e-13 Identities = 37/47 (78%), Positives = 44/47 (93%) Frame = +1 Query: 769 RFPKDSQPGLLRAEDGSKKLIDLGFQFTPMEKIIKDSVESLRSKGYI 909 R PKD+QPGLLR +DGSKKL+DLGFQF PME+IIK++VESL+SKGYI Sbjct: 282 RLPKDTQPGLLRTKDGSKKLMDLGFQFIPMEQIIKETVESLKSKGYI 328 >ref|XP_002526627.1| cinnamoyl-CoA reductase, putative [Ricinus communis] gi|223534067|gb|EEF35786.1| cinnamoyl-CoA reductase, putative [Ricinus communis] Length = 100 Score = 77.4 bits (189), Expect = 7e-12 Identities = 35/48 (72%), Positives = 44/48 (91%) Frame = +1 Query: 769 RFPKDSQPGLLRAEDGSKKLIDLGFQFTPMEKIIKDSVESLRSKGYIP 912 R PKD+QPGLLRA+DG+KKL++LG +F PME+IIKD+VESL+SKG IP Sbjct: 53 RLPKDTQPGLLRAKDGAKKLMELGLEFIPMEQIIKDAVESLKSKGLIP 100 >ref|XP_002526624.1| cinnamoyl-CoA reductase, putative [Ricinus communis] gi|223534064|gb|EEF35783.1| cinnamoyl-CoA reductase, putative [Ricinus communis] Length = 323 Score = 77.4 bits (189), Expect = 7e-12 Identities = 35/48 (72%), Positives = 44/48 (91%) Frame = +1 Query: 769 RFPKDSQPGLLRAEDGSKKLIDLGFQFTPMEKIIKDSVESLRSKGYIP 912 R PKD+QPGLLRA+DG+KKL++LG +F PME+IIKD+VESL+SKG IP Sbjct: 276 RLPKDTQPGLLRAKDGAKKLMELGLEFIPMEQIIKDAVESLKSKGLIP 323 >ref|XP_002275195.1| PREDICTED: dihydroflavonol-4-reductase [Vitis vinifera] gi|297745846|emb|CBI15902.3| unnamed protein product [Vitis vinifera] Length = 329 Score = 77.4 bits (189), Expect = 7e-12 Identities = 37/47 (78%), Positives = 42/47 (89%) Frame = +1 Query: 769 RFPKDSQPGLLRAEDGSKKLIDLGFQFTPMEKIIKDSVESLRSKGYI 909 R PKD+QPGLLRA+ SKKL+DLG QF PME+IIKDSVESLRSKG+I Sbjct: 282 RLPKDTQPGLLRAKTASKKLMDLGLQFIPMEQIIKDSVESLRSKGFI 328 >emb|CAN76154.1| hypothetical protein VITISV_012676 [Vitis vinifera] Length = 326 Score = 77.4 bits (189), Expect = 7e-12 Identities = 37/47 (78%), Positives = 42/47 (89%) Frame = +1 Query: 769 RFPKDSQPGLLRAEDGSKKLIDLGFQFTPMEKIIKDSVESLRSKGYI 909 R PKD+QPGLLRA+ SKKL+DLG QF PME+IIKDSVESLRSKG+I Sbjct: 279 RLPKDTQPGLLRAKTASKKLMDLGLQFIPMEQIIKDSVESLRSKGFI 325