BLASTX nr result
ID: Coptis24_contig00012148
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00012148 (389 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002321646.1| predicted protein [Populus trichocarpa] gi|2... 65 7e-09 ref|XP_002318092.1| predicted protein [Populus trichocarpa] gi|2... 59 4e-07 ref|XP_002511290.1| copine, putative [Ricinus communis] gi|22355... 55 4e-06 >ref|XP_002321646.1| predicted protein [Populus trichocarpa] gi|222868642|gb|EEF05773.1| predicted protein [Populus trichocarpa] Length = 414 Score = 64.7 bits (156), Expect = 7e-09 Identities = 31/50 (62%), Positives = 40/50 (80%), Gaps = 2/50 (4%) Frame = +1 Query: 244 QSPYAQPNSNYGAPQYHAPPPPNYG--ALPQRKLERRYSRINDDYNSLEQ 387 QSPYAQP+ + A Q++APPP +YG A R+LER+YSRI+D+YNSLEQ Sbjct: 27 QSPYAQPSQEHTAYQHYAPPPQSYGDRAPNSRRLERKYSRIDDNYNSLEQ 76 >ref|XP_002318092.1| predicted protein [Populus trichocarpa] gi|222858765|gb|EEE96312.1| predicted protein [Populus trichocarpa] Length = 442 Score = 58.9 bits (141), Expect = 4e-07 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 2/50 (4%) Frame = +1 Query: 244 QSPYAQPNSNYGAPQYHAPPPPNYG--ALPQRKLERRYSRINDDYNSLEQ 387 QSPYAQP+ Y Q++ PPP +YG A R+LER+YS+I+D+YNSL Q Sbjct: 36 QSPYAQPSQEYMQYQHYVPPPQSYGDPAPNSRRLERKYSKIDDNYNSLVQ 85 >ref|XP_002511290.1| copine, putative [Ricinus communis] gi|223550405|gb|EEF51892.1| copine, putative [Ricinus communis] Length = 433 Score = 55.5 bits (132), Expect = 4e-06 Identities = 27/51 (52%), Positives = 35/51 (68%), Gaps = 3/51 (5%) Frame = +1 Query: 244 QSPYAQPNSNYGAPQYHAPPPPNYGALPQ---RKLERRYSRINDDYNSLEQ 387 Q PYAQP Y A + +AP P +YG R+LER+YS+I+D+YNSLEQ Sbjct: 24 QPPYAQPGQEYMAYENYAPAPQSYGGQAPNSGRRLERKYSKIDDNYNSLEQ 74