BLASTX nr result
ID: Coptis24_contig00011897
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00011897 (298 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275476.2| PREDICTED: ubiquitin carboxyl-terminal hydro... 62 5e-08 emb|CBI21539.3| unnamed protein product [Vitis vinifera] 62 5e-08 emb|CAN60856.1| hypothetical protein VITISV_026074 [Vitis vinifera] 62 5e-08 >ref|XP_002275476.2| PREDICTED: ubiquitin carboxyl-terminal hydrolase 27-like [Vitis vinifera] Length = 641 Score = 62.0 bits (149), Expect = 5e-08 Identities = 26/50 (52%), Positives = 36/50 (72%) Frame = +1 Query: 1 IESLKCCTKEDSCDCRNLFPQDAILSSNSFSCTIKQLRITRCPKVCIVKI 150 I+ L+CC ++ SCDCRNL +A+ SNSFS T+KQL I RCPK+ + + Sbjct: 318 IQKLRCCREQGSCDCRNLLNLEAVPWSNSFSRTLKQLSIVRCPKILCIHL 367 >emb|CBI21539.3| unnamed protein product [Vitis vinifera] Length = 532 Score = 62.0 bits (149), Expect = 5e-08 Identities = 26/50 (52%), Positives = 36/50 (72%) Frame = +1 Query: 1 IESLKCCTKEDSCDCRNLFPQDAILSSNSFSCTIKQLRITRCPKVCIVKI 150 I+ L+CC ++ SCDCRNL +A+ SNSFS T+KQL I RCPK+ + + Sbjct: 263 IQKLRCCREQGSCDCRNLLNLEAVPWSNSFSRTLKQLSIVRCPKILCIHL 312 >emb|CAN60856.1| hypothetical protein VITISV_026074 [Vitis vinifera] Length = 559 Score = 62.0 bits (149), Expect = 5e-08 Identities = 26/50 (52%), Positives = 36/50 (72%) Frame = +1 Query: 1 IESLKCCTKEDSCDCRNLFPQDAILSSNSFSCTIKQLRITRCPKVCIVKI 150 I+ L+CC ++ SCDCRNL +A+ SNSFS T+KQL I RCPK+ + + Sbjct: 263 IQKLRCCREQGSCDCRNLLNLEAVPWSNSFSRTLKQLSIVRCPKILCIHL 312