BLASTX nr result
ID: Coptis24_contig00011053
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00011053 (636 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003516776.1| PREDICTED: uncharacterized protein LOC100780... 59 6e-07 ref|XP_003636002.1| Gamma-tubulin complex component [Medicago tr... 57 2e-06 ref|XP_002515845.1| gamma-tubulin complex component, putative [R... 57 2e-06 >ref|XP_003516776.1| PREDICTED: uncharacterized protein LOC100780017 [Glycine max] Length = 1179 Score = 59.3 bits (142), Expect = 6e-07 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +3 Query: 3 LNHFVSMLQQYVQSQLSDVSWCKFLHSLKHQV 98 +NHFVS LQQYV+SQLS VSWC+FLHSL+H+V Sbjct: 1020 INHFVSTLQQYVESQLSHVSWCRFLHSLQHKV 1051 >ref|XP_003636002.1| Gamma-tubulin complex component [Medicago truncatula] gi|355501937|gb|AES83140.1| Gamma-tubulin complex component [Medicago truncatula] Length = 1206 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = +3 Query: 3 LNHFVSMLQQYVQSQLSDVSWCKFLHSLKHQV 98 ++HFVS LQQYV+SQLS VSWC+FLHSL+H+V Sbjct: 1034 ISHFVSTLQQYVESQLSHVSWCRFLHSLQHKV 1065 >ref|XP_002515845.1| gamma-tubulin complex component, putative [Ricinus communis] gi|223545000|gb|EEF46514.1| gamma-tubulin complex component, putative [Ricinus communis] Length = 1209 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/32 (71%), Positives = 30/32 (93%) Frame = +3 Query: 3 LNHFVSMLQQYVQSQLSDVSWCKFLHSLKHQV 98 +NHF+S LQQYVQSQLS +SWC+FLH+LK++V Sbjct: 1052 VNHFISTLQQYVQSQLSHISWCRFLHNLKYKV 1083