BLASTX nr result
ID: Coptis24_contig00010843
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00010843 (317 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002330103.1| predicted protein [Populus trichocarpa] gi|2... 58 9e-07 ref|XP_002514716.1| conserved hypothetical protein [Ricinus comm... 55 5e-06 >ref|XP_002330103.1| predicted protein [Populus trichocarpa] gi|222871237|gb|EEF08368.1| predicted protein [Populus trichocarpa] Length = 275 Score = 57.8 bits (138), Expect = 9e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +2 Query: 224 LHLQEESTLVKIDIRCRVQGDVVLKCIHLDE 316 L+ QEE TLVKIDIRCR+QGDVVL+CIHLDE Sbjct: 196 LYQQEECTLVKIDIRCRIQGDVVLECIHLDE 226 >ref|XP_002514716.1| conserved hypothetical protein [Ricinus communis] gi|223546320|gb|EEF47822.1| conserved hypothetical protein [Ricinus communis] Length = 1550 Score = 55.5 bits (132), Expect = 5e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +2 Query: 227 HLQEESTLVKIDIRCRVQGDVVLKCIHLDE 316 +LQEE LVKID+RCRVQGDVV++CIHLDE Sbjct: 257 YLQEECMLVKIDVRCRVQGDVVIECIHLDE 286