BLASTX nr result
ID: Coptis24_contig00010822
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00010822 (579 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002324749.1| predicted protein [Populus trichocarpa] gi|3... 60 3e-07 ref|XP_002466735.1| hypothetical protein SORBIDRAFT_01g013180 [S... 55 8e-06 >ref|XP_002324749.1| predicted protein [Populus trichocarpa] gi|353558759|sp|B9INH0.1|GATC_POPTR RecName: Full=Glutamyl-tRNA(Gln) amidotransferase subunit C, chloroplastic/mitochondrial; Short=Glu-AdT subunit C; Flags: Precursor gi|222866183|gb|EEF03314.1| predicted protein [Populus trichocarpa] Length = 141 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +3 Query: 3 ETFENREAIIAAVPNYDDPYIKVPQVVNKE 92 ETFENREAIIAAVPNY+DPY+KVP+V+NKE Sbjct: 112 ETFENREAIIAAVPNYEDPYVKVPKVLNKE 141 >ref|XP_002466735.1| hypothetical protein SORBIDRAFT_01g013180 [Sorghum bicolor] gi|353558762|sp|C5WR30.1|GATC_SORBI RecName: Full=Glutamyl-tRNA(Gln) amidotransferase subunit C, chloroplastic/mitochondrial; Short=Glu-AdT subunit C; Flags: Precursor gi|241920589|gb|EER93733.1| hypothetical protein SORBIDRAFT_01g013180 [Sorghum bicolor] Length = 146 Score = 55.1 bits (131), Expect = 8e-06 Identities = 22/30 (73%), Positives = 29/30 (96%) Frame = +3 Query: 3 ETFENREAIIAAVPNYDDPYIKVPQVVNKE 92 ETF+NR+AI+ A+P+YDDPYIKVP+V+NKE Sbjct: 117 ETFDNRDAIVEAIPSYDDPYIKVPRVLNKE 146