BLASTX nr result
ID: Coptis24_contig00010643
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00010643 (1388 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002303360.1| predicted protein [Populus trichocarpa] gi|2... 67 1e-08 ref|XP_004158134.1| PREDICTED: inositol 2-dehydrogenase 2-like [... 65 5e-08 ref|XP_004152397.1| PREDICTED: inositol 2-dehydrogenase 2-like [... 65 5e-08 ref|XP_002530658.1| oxidoreductase, putative [Ricinus communis] ... 65 5e-08 gb|AFK33337.1| unknown [Medicago truncatula] 64 9e-08 >ref|XP_002303360.1| predicted protein [Populus trichocarpa] gi|222840792|gb|EEE78339.1| predicted protein [Populus trichocarpa] Length = 376 Score = 67.0 bits (162), Expect = 1e-08 Identities = 32/55 (58%), Positives = 40/55 (72%), Gaps = 4/55 (7%) Frame = +3 Query: 1062 GTKEVVDSGTC----VVNPNMTHFRIPMDIMNRPKPHPTLVRKSLCTTVT*CKRV 1214 G +E++DSG C V +PNMTH+RI MDI++ PKPH LV K LCTTV CK+V Sbjct: 69 GHRELLDSGLCDVVVVSSPNMTHYRILMDIISHPKPHHVLVEKPLCTTVADCKKV 123 >ref|XP_004158134.1| PREDICTED: inositol 2-dehydrogenase 2-like [Cucumis sativus] Length = 372 Score = 64.7 bits (156), Expect = 5e-08 Identities = 31/55 (56%), Positives = 38/55 (69%), Gaps = 4/55 (7%) Frame = +3 Query: 1062 GTKEVVDSGTC----VVNPNMTHFRIPMDIMNRPKPHPTLVRKSLCTTVT*CKRV 1214 G +E++DSG C V PNMTH++I MDI+N P+PH LV K LCTTV CK V Sbjct: 69 GHQELLDSGLCDVLVVSTPNMTHYQILMDIINHPRPHHVLVEKPLCTTVAHCKEV 123 >ref|XP_004152397.1| PREDICTED: inositol 2-dehydrogenase 2-like [Cucumis sativus] Length = 372 Score = 64.7 bits (156), Expect = 5e-08 Identities = 31/55 (56%), Positives = 38/55 (69%), Gaps = 4/55 (7%) Frame = +3 Query: 1062 GTKEVVDSGTC----VVNPNMTHFRIPMDIMNRPKPHPTLVRKSLCTTVT*CKRV 1214 G +E++DSG C V PNMTH++I MDI+N P+PH LV K LCTTV CK V Sbjct: 69 GHQELLDSGLCDVLVVSTPNMTHYQILMDIINHPRPHHVLVEKPLCTTVAHCKEV 123 >ref|XP_002530658.1| oxidoreductase, putative [Ricinus communis] gi|223529791|gb|EEF31727.1| oxidoreductase, putative [Ricinus communis] Length = 374 Score = 64.7 bits (156), Expect = 5e-08 Identities = 31/55 (56%), Positives = 39/55 (70%), Gaps = 4/55 (7%) Frame = +3 Query: 1062 GTKEVVDSGTC----VVNPNMTHFRIPMDIMNRPKPHPTLVRKSLCTTVT*CKRV 1214 G +E++DSG C V +PNMTH++I MDI+N PKPH LV K LCTTV C +V Sbjct: 63 GHQELLDSGLCDAVVVSSPNMTHYQILMDIINHPKPHHVLVEKPLCTTVADCMKV 117 >gb|AFK33337.1| unknown [Medicago truncatula] Length = 173 Score = 63.9 bits (154), Expect = 9e-08 Identities = 32/55 (58%), Positives = 37/55 (67%), Gaps = 4/55 (7%) Frame = +3 Query: 1062 GTKEVVDSGTC----VVNPNMTHFRIPMDIMNRPKPHPTLVRKSLCTTVT*CKRV 1214 G KE++DSG C V PNMTH+ I MDI+N KPH LV K LCTTV+ CK V Sbjct: 66 GHKELLDSGLCDVLVVSTPNMTHYSILMDIINHSKPHHVLVEKPLCTTVSHCKEV 120