BLASTX nr result
ID: Coptis24_contig00010641
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00010641 (224 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002273919.1| PREDICTED: 60S ribosomal protein L24, mitoch... 79 5e-13 emb|CAN79404.1| hypothetical protein VITISV_028074 [Vitis vinifera] 79 5e-13 ref|XP_002867301.1| ribosomal protein L28 family protein [Arabid... 70 1e-10 ref|XP_002527543.1| 60S ribosomal protein L24, mitochondrial pre... 70 1e-10 ref|XP_003538044.1| PREDICTED: 39S ribosomal protein L28, mitoch... 70 2e-10 >ref|XP_002273919.1| PREDICTED: 60S ribosomal protein L24, mitochondrial [Vitis vinifera] gi|302142683|emb|CBI19886.3| unnamed protein product [Vitis vinifera] Length = 216 Score = 78.6 bits (192), Expect = 5e-13 Identities = 40/56 (71%), Positives = 44/56 (78%), Gaps = 5/56 (8%) Frame = -1 Query: 224 IDEYLLKTPSHKMDTEMGFFWKAKMEKMYKEQELRQMDV-----EDEAKFEHGFKD 72 IDEYLLKTP HKMDTEMG FWKAK+EKMY +EL +MDV EDE KFE GFK+ Sbjct: 103 IDEYLLKTPYHKMDTEMGLFWKAKIEKMY--EELGEMDVVFFSPEDEVKFEQGFKE 156 >emb|CAN79404.1| hypothetical protein VITISV_028074 [Vitis vinifera] Length = 1084 Score = 78.6 bits (192), Expect = 5e-13 Identities = 40/56 (71%), Positives = 44/56 (78%), Gaps = 5/56 (8%) Frame = -1 Query: 224 IDEYLLKTPSHKMDTEMGFFWKAKMEKMYKEQELRQMDV-----EDEAKFEHGFKD 72 IDEYLLKTP HKMDTEMG FWKAK+EKMY +EL +MDV EDE KFE GFK+ Sbjct: 103 IDEYLLKTPYHKMDTEMGLFWKAKIEKMY--EELGEMDVVFFSPEDEVKFEQGFKE 156 >ref|XP_002867301.1| ribosomal protein L28 family protein [Arabidopsis lyrata subsp. lyrata] gi|297313137|gb|EFH43560.1| ribosomal protein L28 family protein [Arabidopsis lyrata subsp. lyrata] Length = 212 Score = 70.5 bits (171), Expect = 1e-10 Identities = 37/56 (66%), Positives = 41/56 (73%), Gaps = 5/56 (8%) Frame = -1 Query: 224 IDEYLLKTPSHKMDTEMGFFWKAKMEKMYKEQELRQMDV-----EDEAKFEHGFKD 72 IDEYLLKTP KMDTEMG +WK K+E+ Y EL QM+V EDEAKFE GFKD Sbjct: 107 IDEYLLKTPYQKMDTEMGLYWKTKVEQRY--AELGQMEVAFFTPEDEAKFEQGFKD 160 >ref|XP_002527543.1| 60S ribosomal protein L24, mitochondrial precursor, putative [Ricinus communis] gi|223533093|gb|EEF34852.1| 60S ribosomal protein L24, mitochondrial precursor, putative [Ricinus communis] Length = 211 Score = 70.5 bits (171), Expect = 1e-10 Identities = 34/54 (62%), Positives = 41/54 (75%), Gaps = 3/54 (5%) Frame = -1 Query: 224 IDEYLLKTPSHKMDTEMGFFWKAKMEKMYKE---QELRQMDVEDEAKFEHGFKD 72 IDEYLLKTP KMDT+MG FWKAK+EK+Y++ +E+ EDEAKFE G KD Sbjct: 107 IDEYLLKTPYQKMDTDMGLFWKAKIEKLYEDLGKREIVFFPPEDEAKFEQGLKD 160 >ref|XP_003538044.1| PREDICTED: 39S ribosomal protein L28, mitochondrial-like [Glycine max] Length = 235 Score = 70.1 bits (170), Expect = 2e-10 Identities = 34/54 (62%), Positives = 40/54 (74%), Gaps = 3/54 (5%) Frame = -1 Query: 224 IDEYLLKTPSHKMDTEMGFFWKAKMEKMYKE---QELRQMDVEDEAKFEHGFKD 72 IDEYL+KTP HKMDTEMG WKAK+EK+Y+E +E+ EDEAKFE F D Sbjct: 107 IDEYLMKTPYHKMDTEMGILWKAKIEKLYEELGNKEVVFFSPEDEAKFEQEFND 160