BLASTX nr result
ID: Coptis24_contig00010267
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00010267 (246 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003596713.1| Shaggy-related protein kinase [Medicago trun... 93 2e-17 ref|XP_003596712.1| Shaggy-related protein kinase [Medicago trun... 93 2e-17 ref|XP_002889601.1| hypothetical protein ARALYDRAFT_470656 [Arab... 93 2e-17 ref|NP_172127.1| Shaggy-related protein kinase iota [Arabidopsis... 93 3e-17 ref|XP_003541881.1| PREDICTED: shaggy-related protein kinase iot... 93 3e-17 >ref|XP_003596713.1| Shaggy-related protein kinase [Medicago truncatula] gi|355485761|gb|AES66964.1| Shaggy-related protein kinase [Medicago truncatula] Length = 294 Score = 93.2 bits (230), Expect = 2e-17 Identities = 46/57 (80%), Positives = 49/57 (85%) Frame = +1 Query: 1 YQIFRGLAYIHTVHGVSHRDVKPQNLLVDPLTHQVKLCDFGSEKVLIALSKKVSISY 171 YQIFRGLAYIHTV GV HRDVKPQNLLVDPLTHQVKLCDFGS KVL+ + +ISY Sbjct: 62 YQIFRGLAYIHTVPGVCHRDVKPQNLLVDPLTHQVKLCDFGSAKVLV--KGEANISY 116 >ref|XP_003596712.1| Shaggy-related protein kinase [Medicago truncatula] gi|355485760|gb|AES66963.1| Shaggy-related protein kinase [Medicago truncatula] Length = 423 Score = 93.2 bits (230), Expect = 2e-17 Identities = 46/57 (80%), Positives = 49/57 (85%) Frame = +1 Query: 1 YQIFRGLAYIHTVHGVSHRDVKPQNLLVDPLTHQVKLCDFGSEKVLIALSKKVSISY 171 YQIFRGLAYIHTV GV HRDVKPQNLLVDPLTHQVKLCDFGS KVL+ + +ISY Sbjct: 191 YQIFRGLAYIHTVPGVCHRDVKPQNLLVDPLTHQVKLCDFGSAKVLV--KGEANISY 245 >ref|XP_002889601.1| hypothetical protein ARALYDRAFT_470656 [Arabidopsis lyrata subsp. lyrata] gi|297335443|gb|EFH65860.1| hypothetical protein ARALYDRAFT_470656 [Arabidopsis lyrata subsp. lyrata] Length = 410 Score = 93.2 bits (230), Expect = 2e-17 Identities = 46/57 (80%), Positives = 49/57 (85%) Frame = +1 Query: 1 YQIFRGLAYIHTVHGVSHRDVKPQNLLVDPLTHQVKLCDFGSEKVLIALSKKVSISY 171 YQIFRGLAYIHTV GV HRDVKPQNLLVDPLTHQVKLCDFGS KVL+ + +ISY Sbjct: 179 YQIFRGLAYIHTVPGVCHRDVKPQNLLVDPLTHQVKLCDFGSAKVLV--KGEANISY 233 >ref|NP_172127.1| Shaggy-related protein kinase iota [Arabidopsis thaliana] gi|42571361|ref|NP_973771.1| Shaggy-related protein kinase iota [Arabidopsis thaliana] gi|11133004|sp|Q39012.1|KSG9_ARATH RecName: Full=Shaggy-related protein kinase iota; AltName: Full=ASK-iota gi|8927676|gb|AAF82167.1|AC068143_9 Contains a very strong similarity to a shaggy-like kinase iota from Arabidopsis thaliana gb|X99696 and contains an eukaryotic protein kinase PF|00069 domain. EST gb|N37432 comes from this gene [Arabidopsis thaliana] gi|1480078|emb|CAA68027.1| shaggy-like protein kinase iota [Arabidopsis thaliana] gi|2444277|gb|AAB71545.1| GSK3/shaggy-like protein kinase [Arabidopsis thaliana] gi|14334750|gb|AAK59553.1| putative shaggy kinase [Arabidopsis thaliana] gi|15293239|gb|AAK93730.1| putative shaggy kinase [Arabidopsis thaliana] gi|332189859|gb|AEE27980.1| Shaggy-related protein kinase iota [Arabidopsis thaliana] gi|332189860|gb|AEE27981.1| Shaggy-related protein kinase iota [Arabidopsis thaliana] Length = 407 Score = 92.8 bits (229), Expect = 3e-17 Identities = 44/54 (81%), Positives = 46/54 (85%) Frame = +1 Query: 1 YQIFRGLAYIHTVHGVSHRDVKPQNLLVDPLTHQVKLCDFGSEKVLIALSKKVS 162 YQIFRGLAYIHTV GV HRDVKPQNLLVDPLTHQVKLCDFGS KVL+ +S Sbjct: 176 YQIFRGLAYIHTVPGVCHRDVKPQNLLVDPLTHQVKLCDFGSAKVLVKGEPNIS 229 >ref|XP_003541881.1| PREDICTED: shaggy-related protein kinase iota-like [Glycine max] Length = 482 Score = 92.8 bits (229), Expect = 3e-17 Identities = 43/54 (79%), Positives = 46/54 (85%) Frame = +1 Query: 1 YQIFRGLAYIHTVHGVSHRDVKPQNLLVDPLTHQVKLCDFGSEKVLIALSKKVS 162 YQIFRGLAYIHTV G+ HRDVKPQNLLVDPLTHQVKLCDFGS KVL+ +S Sbjct: 244 YQIFRGLAYIHTVPGICHRDVKPQNLLVDPLTHQVKLCDFGSAKVLVEGESNIS 297