BLASTX nr result
ID: Coptis24_contig00010067
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00010067 (306 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003539233.1| PREDICTED: U-box domain-containing protein 4... 62 4e-08 ref|XP_004142315.1| PREDICTED: putative U-box domain-containing ... 59 3e-07 ref|XP_002304783.1| predicted protein [Populus trichocarpa] gi|2... 58 9e-07 ref|XP_003598693.1| U-box domain-containing protein [Medicago tr... 57 1e-06 ref|XP_002265237.1| PREDICTED: U-box domain-containing protein 4... 57 1e-06 >ref|XP_003539233.1| PREDICTED: U-box domain-containing protein 43-like [Glycine max] Length = 831 Score = 62.4 bits (150), Expect = 4e-08 Identities = 33/81 (40%), Positives = 54/81 (66%), Gaps = 1/81 (1%) Frame = -3 Query: 241 DTQPFFDLLSKLLTTVQELVSLSENTHIQRELFTDFALLVHQFTPILEELRE-SYIIEKT 65 + + F LLS+L+ E+ S++ N+ I+ ++F +FA+LV + PI +LRE + +++K Sbjct: 5 EERKFSKLLSELIVLADEVSSIAMNSEIEVDIFAEFAMLVEKLPPIFNDLREKNTVLDKP 64 Query: 64 TIIKSLESLHTELKRAITLIQ 2 I KSLESL EL+RA LI+ Sbjct: 65 PIRKSLESLENELRRAKALIK 85 >ref|XP_004142315.1| PREDICTED: putative U-box domain-containing protein 42-like [Cucumis sativus] gi|449530418|ref|XP_004172192.1| PREDICTED: putative U-box domain-containing protein 42-like [Cucumis sativus] Length = 812 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/79 (34%), Positives = 54/79 (68%), Gaps = 1/79 (1%) Frame = -3 Query: 250 QKKDTQPFFDLLSKLLTTVQELVSLSENTHIQRELFTDFALLVHQFTPILEELRE-SYII 74 ++ + + F +++S+++ + EL S+S+N+ + E+FT+ AL++ + PI +LR+ I+ Sbjct: 2 KEMENRTFSEVVSEIIASTDELASISKNSETENEMFTELALVLEKIPPIFNDLRDYDKIV 61 Query: 73 EKTTIIKSLESLHTELKRA 17 + TI K++ESL E+KRA Sbjct: 62 DTPTIRKAVESLEKEIKRA 80 >ref|XP_002304783.1| predicted protein [Populus trichocarpa] gi|222842215|gb|EEE79762.1| predicted protein [Populus trichocarpa] Length = 848 Score = 57.8 bits (138), Expect = 9e-07 Identities = 27/84 (32%), Positives = 57/84 (67%), Gaps = 1/84 (1%) Frame = -3 Query: 250 QKKDTQPFFDLLSKLLTTVQELVSLSENTHIQRELFTDFALLVHQFTPILEELRES-YII 74 + D++ ++ S+ + +E+VSL++N+ RE+FT+FA+L+ +FTP+L ++++ ++ Sbjct: 2 ENPDSRSISEIESEQQASTEEVVSLAKNSEFDREIFTEFAVLLDKFTPVLVAIKDNEKLM 61 Query: 73 EKTTIIKSLESLHTELKRAITLIQ 2 ++ + K +ES+ EL RA LI+ Sbjct: 62 DRPPVKKGVESIEKELTRAKKLIE 85 >ref|XP_003598693.1| U-box domain-containing protein [Medicago truncatula] gi|355487741|gb|AES68944.1| U-box domain-containing protein [Medicago truncatula] Length = 827 Score = 57.4 bits (137), Expect = 1e-06 Identities = 31/79 (39%), Positives = 51/79 (64%), Gaps = 1/79 (1%) Frame = -3 Query: 241 DTQPFFDLLSKLLTTVQELVSLSENTHIQRELFTDFALLVHQFTPILEELRE-SYIIEKT 65 + + F +L+S + E+VS + T I+ + F++F++LV + PIL EL + S +++K Sbjct: 2 EKREFSELVSTMNFLADEVVSFGKKTEIEVDAFSEFSMLVEKLPPILNELSDNSVVLDKP 61 Query: 64 TIIKSLESLHTELKRAITL 8 +I KSLESL EL+RA L Sbjct: 62 SIRKSLESLENELRRAKAL 80 >ref|XP_002265237.1| PREDICTED: U-box domain-containing protein 43-like [Vitis vinifera] Length = 882 Score = 57.4 bits (137), Expect = 1e-06 Identities = 29/79 (36%), Positives = 55/79 (69%) Frame = -3 Query: 238 TQPFFDLLSKLLTTVQELVSLSENTHIQRELFTDFALLVHQFTPILEELRESYIIEKTTI 59 T+ F +LL++ + E+ SLS+++ ++E+ +FA LV +F PIL++LRE+ +++ +I Sbjct: 5 TKTFSELLAERQASAGEVASLSKDSETEQEILAEFASLVAKFGPILDDLRENKVMDTPSI 64 Query: 58 IKSLESLHTELKRAITLIQ 2 +++ESL EL RA L++ Sbjct: 65 REAVESLEKELGRARGLMK 83