BLASTX nr result
ID: Coptis24_contig00010050
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00010050 (1655 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002447246.1| hypothetical protein SORBIDRAFT_06g031195 [S... 58 6e-06 >ref|XP_002447246.1| hypothetical protein SORBIDRAFT_06g031195 [Sorghum bicolor] gi|241938429|gb|EES11574.1| hypothetical protein SORBIDRAFT_06g031195 [Sorghum bicolor] Length = 371 Score = 58.2 bits (139), Expect = 6e-06 Identities = 32/65 (49%), Positives = 39/65 (60%), Gaps = 4/65 (6%) Frame = -2 Query: 274 RFDKLREGIGIEEKDRVKAETLSSVALRCVHYMPQRRPSMSTVVKMLEEE----NPTLKF 107 +FD + GI KDR KAE + VAL CV Y P+ RPSMS+VV+MLE E P F Sbjct: 286 KFDDVMAASGIHAKDREKAERMCKVALWCVQYQPEARPSMSSVVRMLEGEEEIARPVNPF 345 Query: 106 RVMSS 92 M+S Sbjct: 346 AYMAS 350