BLASTX nr result
ID: Coptis24_contig00009975
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00009975 (309 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512959.1| beta-galactosidase, putative [Ricinus commun... 56 2e-14 dbj|BAF31234.1| beta-D-galactosidase [Persea americana] 55 3e-14 ref|XP_002274449.2| PREDICTED: beta-galactosidase 3 [Vitis vinif... 56 5e-14 emb|CBI17431.3| unnamed protein product [Vitis vinifera] 56 5e-14 ref|XP_004146490.1| PREDICTED: beta-galactosidase 3-like [Cucumi... 55 3e-13 >ref|XP_002512959.1| beta-galactosidase, putative [Ricinus communis] gi|223547970|gb|EEF49462.1| beta-galactosidase, putative [Ricinus communis] Length = 732 Score = 55.8 bits (133), Expect(2) = 2e-14 Identities = 22/25 (88%), Positives = 25/25 (100%) Frame = -1 Query: 174 YDYDAPIDEYGLVRQPKFGHLKNLH 100 YDYDAPIDEYGL+RQPK+GHLK+LH Sbjct: 313 YDYDAPIDEYGLIRQPKYGHLKDLH 337 Score = 47.8 bits (112), Expect(2) = 2e-14 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = -2 Query: 95 AIKLCEGALISVDPVTTSLGSFQQENVFSSN 3 AIKLCE AL+S DPV T+LGS++Q +VFSSN Sbjct: 339 AIKLCERALLSSDPVVTTLGSYEQAHVFSSN 369 >dbj|BAF31234.1| beta-D-galactosidase [Persea americana] Length = 849 Score = 55.5 bits (132), Expect(2) = 3e-14 Identities = 22/25 (88%), Positives = 24/25 (96%) Frame = -1 Query: 174 YDYDAPIDEYGLVRQPKFGHLKNLH 100 YDYDAPIDEYGL+RQPK+GHLK LH Sbjct: 315 YDYDAPIDEYGLIRQPKYGHLKELH 339 Score = 47.4 bits (111), Expect(2) = 3e-14 Identities = 22/30 (73%), Positives = 25/30 (83%) Frame = -2 Query: 95 AIKLCEGALISVDPVTTSLGSFQQENVFSS 6 AIKLCE ALIS DP+ TSLG +QQ +VFSS Sbjct: 341 AIKLCEPALISADPIVTSLGPYQQSHVFSS 370 >ref|XP_002274449.2| PREDICTED: beta-galactosidase 3 [Vitis vinifera] Length = 898 Score = 55.8 bits (133), Expect(2) = 5e-14 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = -1 Query: 174 YDYDAPIDEYGLVRQPKFGHLKNLH 100 YDYDAPIDEYGLVRQPK+GHLK LH Sbjct: 366 YDYDAPIDEYGLVRQPKYGHLKELH 390 Score = 46.2 bits (108), Expect(2) = 5e-14 Identities = 20/31 (64%), Positives = 27/31 (87%) Frame = -2 Query: 95 AIKLCEGALISVDPVTTSLGSFQQENVFSSN 3 +IKLCE AL+S DP+ +SLGSFQQ +V+SS+ Sbjct: 392 SIKLCERALVSADPIVSSLGSFQQAHVYSSD 422 >emb|CBI17431.3| unnamed protein product [Vitis vinifera] Length = 845 Score = 55.8 bits (133), Expect(2) = 5e-14 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = -1 Query: 174 YDYDAPIDEYGLVRQPKFGHLKNLH 100 YDYDAPIDEYGLVRQPK+GHLK LH Sbjct: 313 YDYDAPIDEYGLVRQPKYGHLKELH 337 Score = 46.2 bits (108), Expect(2) = 5e-14 Identities = 20/31 (64%), Positives = 27/31 (87%) Frame = -2 Query: 95 AIKLCEGALISVDPVTTSLGSFQQENVFSSN 3 +IKLCE AL+S DP+ +SLGSFQQ +V+SS+ Sbjct: 339 SIKLCERALVSADPIVSSLGSFQQAHVYSSD 369 >ref|XP_004146490.1| PREDICTED: beta-galactosidase 3-like [Cucumis sativus] gi|449500002|ref|XP_004160975.1| PREDICTED: beta-galactosidase 3-like [Cucumis sativus] Length = 846 Score = 54.7 bits (130), Expect(2) = 3e-13 Identities = 22/25 (88%), Positives = 24/25 (96%) Frame = -1 Query: 174 YDYDAPIDEYGLVRQPKFGHLKNLH 100 YDYDAPIDEYGL+RQPK+GHLK LH Sbjct: 312 YDYDAPIDEYGLLRQPKYGHLKELH 336 Score = 45.1 bits (105), Expect(2) = 3e-13 Identities = 19/30 (63%), Positives = 25/30 (83%) Frame = -2 Query: 95 AIKLCEGALISVDPVTTSLGSFQQENVFSS 6 AIK+CE AL+S DP+ TSLG +QQ +V+SS Sbjct: 338 AIKMCEPALVSADPIVTSLGDYQQAHVYSS 367