BLASTX nr result
ID: Coptis24_contig00009763
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00009763 (328 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002297751.1| cc-nbs-lrr resistance protein [Populus trich... 56 3e-06 >ref|XP_002297751.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222845009|gb|EEE82556.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Length = 1093 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/62 (43%), Positives = 42/62 (67%) Frame = +2 Query: 32 FASAAVQVVLERLWDFMVREIGAMLNANEGFKKLERTLLRVQAMLDDVEDKEISHKAWKI 211 F SA +QV LE L ++RE GA + ++ KKL RTL ++QA+L+D E ++I+ A K+ Sbjct: 9 FLSATLQVALENLASPILREFGARIGIDKDLKKLTRTLAKIQAVLNDAEARQINDMAVKL 68 Query: 212 WV 217 W+ Sbjct: 69 WL 70