BLASTX nr result
ID: Coptis24_contig00009750
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00009750 (339 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002300674.1| predicted protein [Populus trichocarpa] gi|2... 42 1e-06 ref|XP_002510618.1| ubiquitin-protein ligase, putative [Ricinus ... 41 5e-06 >ref|XP_002300674.1| predicted protein [Populus trichocarpa] gi|222842400|gb|EEE79947.1| predicted protein [Populus trichocarpa] Length = 393 Score = 42.4 bits (98), Expect(2) = 1e-06 Identities = 16/46 (34%), Positives = 30/46 (65%) Frame = -2 Query: 329 GDETWTIIDSPPQQAHSDILFFNGRFYAIHAGGILRICEIDEPVPK 192 GDE W I+++ + D+++FNG FYA++ G + +C+++ PK Sbjct: 199 GDECWNIVENS-RSFSEDVIYFNGLFYAVNKAGQIVVCDVNGNSPK 243 Score = 34.7 bits (78), Expect(2) = 1e-06 Identities = 21/53 (39%), Positives = 27/53 (50%) Frame = -3 Query: 166 DRFYLVEISGHLHLVARALDKDYNAPEGVFRYVTDWFEVYRLDFSAKKWIELT 8 D YLV L LV R LD D +F Y T FEV++LD + +W +T Sbjct: 256 DMQYLVSSGDGLLLVTRYLDLDVEFD--IFIYKTARFEVFKLDLNGPRWERVT 306 >ref|XP_002510618.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223551319|gb|EEF52805.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 398 Score = 40.8 bits (94), Expect(2) = 5e-06 Identities = 16/48 (33%), Positives = 31/48 (64%) Frame = -2 Query: 335 RPGDETWTIIDSPPQQAHSDILFFNGRFYAIHAGGILRICEIDEPVPK 192 R GD++W+++++ + D++F NG FYA++ G + IC+I P+ Sbjct: 196 RNGDKSWSLVENA-RSFCEDVIFVNGMFYAVNKAGQIVICDISSDSPR 242 Score = 34.3 bits (77), Expect(2) = 5e-06 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 6/59 (10%) Frame = -3 Query: 166 DRFYLVEISGHLHLVARALDKDYN------APEGVFRYVTDWFEVYRLDFSAKKWIELT 8 D YLV L LV R LD +Y P ++R + FEV+RLD++ +W+ ++ Sbjct: 255 DMQYLVNSGDELLLVTRYLDLEYEFDHPDMEPHLIYRTIR--FEVFRLDWNGPQWLRMS 311