BLASTX nr result
ID: Coptis24_contig00009440
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00009440 (422 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276721.1| PREDICTED: phosphatidylinositol glycan ancho... 57 1e-06 ref|XP_003550876.1| PREDICTED: phosphatidylinositol glycan ancho... 57 2e-06 ref|XP_003525538.1| PREDICTED: phosphatidylinositol glycan ancho... 57 2e-06 >ref|XP_002276721.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class U protein [Vitis vinifera] gi|297742569|emb|CBI34718.3| unnamed protein product [Vitis vinifera] Length = 474 Score = 57.4 bits (137), Expect = 1e-06 Identities = 23/40 (57%), Positives = 33/40 (82%) Frame = +2 Query: 29 FSWRPVIYFLLRAAIWSFYTLFVCNISLQQYGGLSKMFKS 148 FSWR V++F+L A++WS Y L +C IS+++YGGL +MFKS Sbjct: 267 FSWRLVVHFILWASLWSCYVLLLCGISVRRYGGLGEMFKS 306 >ref|XP_003550876.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class U protein-like [Glycine max] Length = 468 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/43 (55%), Positives = 30/43 (69%) Frame = +2 Query: 17 VGRSFSWRPVIYFLLRAAIWSFYTLFVCNISLQQYGGLSKMFK 145 V FSWRPV+ FL A +WS Y L +C I +QQYGGL ++FK Sbjct: 252 VANVFSWRPVVLFLFWALLWSSYVLVLCGIYVQQYGGLQELFK 294 >ref|XP_003525538.1| PREDICTED: phosphatidylinositol glycan anchor biosynthesis class U protein-like [Glycine max] Length = 464 Score = 57.0 bits (136), Expect = 2e-06 Identities = 23/43 (53%), Positives = 30/43 (69%) Frame = +2 Query: 17 VGRSFSWRPVIYFLLRAAIWSFYTLFVCNISLQQYGGLSKMFK 145 V FSWRPV++FL +WS Y L +C I +QQYGGL ++FK Sbjct: 248 VANVFSWRPVVFFLFWTLLWSSYVLVLCGICVQQYGGLHELFK 290