BLASTX nr result
ID: Coptis24_contig00009116
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00009116 (552 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514207.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 >ref|XP_002514207.1| conserved hypothetical protein [Ricinus communis] gi|223546663|gb|EEF48161.1| conserved hypothetical protein [Ricinus communis] Length = 78 Score = 57.0 bits (136), Expect = 2e-06 Identities = 30/69 (43%), Positives = 39/69 (56%) Frame = +2 Query: 212 MKDSGKSGKVNGKYGQQDGRKDRRSAXXXXXXXXXXXXXXXFTWAGIGFSHVEIGMEKKY 391 MK++GKS K + + D R+DR+SA FTWAG G+S EIG +K Sbjct: 1 MKNTGKSSKSSTANSKSDARRDRKSATGMSGSPKKGGHGGKFTWAGDGYSPAEIGYQKD- 59 Query: 392 ILDKKDPNF 418 +LD KDPNF Sbjct: 60 VLDAKDPNF 68