BLASTX nr result
ID: Coptis24_contig00008753
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00008753 (346 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002263938.1| PREDICTED: 40S ribosomal protein S29-like [V... 74 2e-11 ref|XP_003633092.1| PREDICTED: 40S ribosomal protein S29-like is... 73 2e-11 ref|XP_002271801.1| PREDICTED: 40S ribosomal protein S29-like [V... 73 2e-11 ref|XP_002313170.1| predicted protein [Populus trichocarpa] gi|2... 72 4e-11 ref|XP_002298768.1| predicted protein [Populus trichocarpa] gi|2... 72 4e-11 >ref|XP_002263938.1| PREDICTED: 40S ribosomal protein S29-like [Vitis vinifera] Length = 56 Score = 73.6 bits (179), Expect = 2e-11 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +3 Query: 255 MGHSNVWNSHPKTYGPGSRTCRVCGNPHGL 344 MGHSNVWNSHPK+YGPGSRTCRVCGNPHGL Sbjct: 1 MGHSNVWNSHPKSYGPGSRTCRVCGNPHGL 30 >ref|XP_003633092.1| PREDICTED: 40S ribosomal protein S29-like isoform 2 [Vitis vinifera] gi|297738544|emb|CBI27789.3| unnamed protein product [Vitis vinifera] Length = 73 Score = 73.2 bits (178), Expect = 2e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 255 MGHSNVWNSHPKTYGPGSRTCRVCGNPHGL 344 MGHSNVWNSHPK YGPGSRTCRVCGNPHGL Sbjct: 1 MGHSNVWNSHPKNYGPGSRTCRVCGNPHGL 30 >ref|XP_002271801.1| PREDICTED: 40S ribosomal protein S29-like [Vitis vinifera] gi|225444692|ref|XP_002277856.1| PREDICTED: 40S ribosomal protein S29-like isoform 1 [Vitis vinifera] gi|255538096|ref|XP_002510113.1| 40S ribosomal protein S29, putative [Ricinus communis] gi|356497504|ref|XP_003517600.1| PREDICTED: 40S ribosomal protein S29-like [Glycine max] gi|356536119|ref|XP_003536587.1| PREDICTED: 40S ribosomal protein S29 [Glycine max] gi|356538933|ref|XP_003537955.1| PREDICTED: 40S ribosomal protein S29-like isoform 1 [Glycine max] gi|356575720|ref|XP_003555985.1| PREDICTED: 40S ribosomal protein S29-like [Glycine max] gi|449438331|ref|XP_004136942.1| PREDICTED: 40S ribosomal protein S29-like [Cucumis sativus] gi|449447053|ref|XP_004141284.1| PREDICTED: 40S ribosomal protein S29-like [Cucumis sativus] gi|449469128|ref|XP_004152273.1| PREDICTED: 40S ribosomal protein S29-like [Cucumis sativus] gi|449484349|ref|XP_004156858.1| PREDICTED: 40S ribosomal protein S29-like [Cucumis sativus] gi|449508184|ref|XP_004163243.1| PREDICTED: 40S ribosomal protein S29-like [Cucumis sativus] gi|449520128|ref|XP_004167086.1| PREDICTED: 40S ribosomal protein S29-like [Cucumis sativus] gi|223550814|gb|EEF52300.1| 40S ribosomal protein S29, putative [Ricinus communis] Length = 56 Score = 73.2 bits (178), Expect = 2e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 255 MGHSNVWNSHPKTYGPGSRTCRVCGNPHGL 344 MGHSNVWNSHPK YGPGSRTCRVCGNPHGL Sbjct: 1 MGHSNVWNSHPKNYGPGSRTCRVCGNPHGL 30 >ref|XP_002313170.1| predicted protein [Populus trichocarpa] gi|222849578|gb|EEE87125.1| predicted protein [Populus trichocarpa] Length = 54 Score = 72.4 bits (176), Expect = 4e-11 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +3 Query: 255 MGHSNVWNSHPKTYGPGSRTCRVCGNPHGL 344 MGHSNVWNSHPK YGPGSRTCRVCGNPHG+ Sbjct: 1 MGHSNVWNSHPKNYGPGSRTCRVCGNPHGI 30 >ref|XP_002298768.1| predicted protein [Populus trichocarpa] gi|222846026|gb|EEE83573.1| predicted protein [Populus trichocarpa] Length = 56 Score = 72.4 bits (176), Expect = 4e-11 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +3 Query: 255 MGHSNVWNSHPKTYGPGSRTCRVCGNPHGL 344 MGHSNVWNSHPK YGPGSRTCRVCGNPHG+ Sbjct: 1 MGHSNVWNSHPKNYGPGSRTCRVCGNPHGI 30