BLASTX nr result
ID: Coptis24_contig00008483
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00008483 (257 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283439.2| PREDICTED: probable disease resistance prote... 62 6e-08 emb|CBI20159.3| unnamed protein product [Vitis vinifera] 62 6e-08 ref|XP_002329155.1| BED finger-nbs-lrr resistance protein [Popul... 60 1e-07 ref|XP_002317519.1| nbs-lrr resistance protein [Populus trichoca... 60 1e-07 ref|XP_002325714.1| BED finger-nbs-lrr resistance protein [Popul... 59 3e-07 >ref|XP_002283439.2| PREDICTED: probable disease resistance protein At4g27220-like [Vitis vinifera] Length = 1276 Score = 61.6 bits (148), Expect = 6e-08 Identities = 30/43 (69%), Positives = 33/43 (76%) Frame = -3 Query: 165 PRLKELEFWNLPKLKSIWKGVMVCDSLQTVEVRNCPELKRLPL 37 P L+ L NLPKLKSIWKG M CDSLQ + V NCPEL+RLPL Sbjct: 1160 PNLQSLTLENLPKLKSIWKGTMTCDSLQ-LTVWNCPELRRLPL 1201 >emb|CBI20159.3| unnamed protein product [Vitis vinifera] Length = 757 Score = 61.6 bits (148), Expect = 6e-08 Identities = 30/43 (69%), Positives = 33/43 (76%) Frame = -3 Query: 165 PRLKELEFWNLPKLKSIWKGVMVCDSLQTVEVRNCPELKRLPL 37 P L+ L NLPKLKSIWKG M CDSLQ + V NCPEL+RLPL Sbjct: 636 PNLQSLTLENLPKLKSIWKGTMTCDSLQ-LTVWNCPELRRLPL 677 >ref|XP_002329155.1| BED finger-nbs-lrr resistance protein [Populus trichocarpa] gi|222869824|gb|EEF06955.1| BED finger-nbs-lrr resistance protein [Populus trichocarpa] Length = 1075 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/56 (51%), Positives = 38/56 (67%) Frame = -3 Query: 168 LPRLKELEFWNLPKLKSIWKGVMVCDSLQTVEVRNCPELKRLPLFNREHQSAPPSL 1 LP LK L+ NLP+LKSI+ G ++CDSLQ + V NCP LKR+ L +R H + L Sbjct: 984 LPNLKVLKLSNLPELKSIFHGEVICDSLQEIIVVNCPNLKRISLSHRNHANGQTPL 1039 >ref|XP_002317519.1| nbs-lrr resistance protein [Populus trichocarpa] gi|222860584|gb|EEE98131.1| nbs-lrr resistance protein [Populus trichocarpa] Length = 958 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/46 (58%), Positives = 38/46 (82%) Frame = -3 Query: 168 LPRLKELEFWNLPKLKSIWKGVMVCDSLQTVEVRNCPELKRLPLFN 31 L +L+ L+ NLP+LKSI++GV++C SLQ + V NCPELKR+PLF+ Sbjct: 866 LSKLRALKLSNLPELKSIFQGVVICGSLQEILVVNCPELKRIPLFD 911 >ref|XP_002325714.1| BED finger-nbs-lrr resistance protein [Populus trichocarpa] gi|222862589|gb|EEF00096.1| BED finger-nbs-lrr resistance protein [Populus trichocarpa] Length = 1010 Score = 59.3 bits (142), Expect = 3e-07 Identities = 29/60 (48%), Positives = 39/60 (65%), Gaps = 4/60 (6%) Frame = -3 Query: 168 LPRLKELEFWNLPKLKSIWKGVMVCDSLQTVEVRNCPELKR----LPLFNREHQSAPPSL 1 LP+L+ +E LP+LKSI ++CDS++ +EVRNC +LKR LPL S PPSL Sbjct: 916 LPKLRNMELRGLPELKSICSAKLICDSIEGIEVRNCEKLKRMPICLPLLENGEPSPPPSL 975