BLASTX nr result
ID: Coptis24_contig00008268
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00008268 (672 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004167183.1| PREDICTED: pentatricopeptide repeat-containi... 56 6e-06 ref|XP_004148967.1| PREDICTED: pentatricopeptide repeat-containi... 56 6e-06 >ref|XP_004167183.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Cucumis sativus] Length = 605 Score = 56.2 bits (134), Expect = 6e-06 Identities = 24/44 (54%), Positives = 33/44 (75%) Frame = +1 Query: 538 DMSKRSISPNVVTFNILVYALCKEGKTNEALQVSELMLQRGIIP 669 +M + + PNVVTFN+L+ LCKEGK EA + E+M+QRGI+P Sbjct: 302 EMVNQGVQPNVVTFNVLIDVLCKEGKVIEAKDLLEVMIQRGIVP 345 >ref|XP_004148967.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Cucumis sativus] Length = 597 Score = 56.2 bits (134), Expect = 6e-06 Identities = 24/44 (54%), Positives = 33/44 (75%) Frame = +1 Query: 538 DMSKRSISPNVVTFNILVYALCKEGKTNEALQVSELMLQRGIIP 669 +M + + PNVVTFN+L+ LCKEGK EA + E+M+QRGI+P Sbjct: 294 EMVNQGVQPNVVTFNVLIDVLCKEGKVIEAKDLLEVMIQRGIVP 337