BLASTX nr result
ID: Coptis24_contig00008077
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00008077 (246 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002327139.1| predicted protein [Populus trichocarpa] gi|2... 62 5e-08 ref|XP_002510219.1| pentatricopeptide repeat-containing protein,... 61 8e-08 ref|XP_002334752.1| predicted protein [Populus trichocarpa] gi|2... 58 7e-07 ref|XP_002301187.1| predicted protein [Populus trichocarpa] gi|2... 58 7e-07 dbj|BAC76729.1| alpha-amylase [Vigna angularis] 57 1e-06 >ref|XP_002327139.1| predicted protein [Populus trichocarpa] gi|222835454|gb|EEE73889.1| predicted protein [Populus trichocarpa] Length = 423 Score = 62.0 bits (149), Expect = 5e-08 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = -2 Query: 98 GFNWESSNKVGGWYNFLKNSIADLANVGVTHV 3 GFNWES NK GGWYN LKNS+ DLAN G+THV Sbjct: 28 GFNWESCNKAGGWYNSLKNSVPDLANAGITHV 59 >ref|XP_002510219.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223550920|gb|EEF52406.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 1113 Score = 61.2 bits (147), Expect = 8e-08 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = -2 Query: 98 GFNWESSNKVGGWYNFLKNSIADLANVGVTHV 3 GFNWES NK GGWYN LKNSI D+AN G+THV Sbjct: 31 GFNWESCNKGGGWYNLLKNSILDIANAGITHV 62 >ref|XP_002334752.1| predicted protein [Populus trichocarpa] gi|222874486|gb|EEF11617.1| predicted protein [Populus trichocarpa] Length = 100 Score = 58.2 bits (139), Expect = 7e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = -2 Query: 98 GFNWESSNKVGGWYNFLKNSIADLANVGVTHV 3 GFNWES N+ GGWYN LKN + DLAN G+THV Sbjct: 28 GFNWESCNQAGGWYNSLKNLVPDLANAGITHV 59 >ref|XP_002301187.1| predicted protein [Populus trichocarpa] gi|222842913|gb|EEE80460.1| predicted protein [Populus trichocarpa] Length = 404 Score = 58.2 bits (139), Expect = 7e-07 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = -2 Query: 98 GFNWESSNKVGGWYNFLKNSIADLANVGVTHV 3 GFNWES N+ GGWYN LKN + DLAN G+THV Sbjct: 9 GFNWESCNQAGGWYNSLKNLVPDLANAGITHV 40 >dbj|BAC76729.1| alpha-amylase [Vigna angularis] Length = 421 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = -2 Query: 98 GFNWESSNKVGGWYNFLKNSIADLANVGVTHV 3 GFNWESS K GGWYN LKNSI DLAN G+THV Sbjct: 29 GFNWESSKK-GGWYNSLKNSIPDLANAGITHV 59