BLASTX nr result
ID: Coptis24_contig00007350
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00007350 (195 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002305141.1| predicted protein [Populus trichocarpa] gi|2... 70 2e-10 emb|CBI20322.3| unnamed protein product [Vitis vinifera] 69 3e-10 ref|XP_002282230.1| PREDICTED: pentatricopeptide repeat-containi... 69 3e-10 ref|XP_003632962.1| PREDICTED: pentatricopeptide repeat-containi... 69 5e-10 emb|CAN64166.1| hypothetical protein VITISV_006333 [Vitis vinifera] 69 5e-10 >ref|XP_002305141.1| predicted protein [Populus trichocarpa] gi|222848105|gb|EEE85652.1| predicted protein [Populus trichocarpa] Length = 492 Score = 69.7 bits (169), Expect = 2e-10 Identities = 30/50 (60%), Positives = 40/50 (80%) Frame = +3 Query: 3 KLLKEWESSGNIYDFRVPNVLLGAYTKRGCTEKAEAMLEDLTNNGKVPIP 152 K+LKEWESSGN YD RVPN L+ Y+++G EKA+A+LE+LT GK+ +P Sbjct: 327 KMLKEWESSGNFYDVRVPNTLIIGYSRKGLCEKAKALLENLTEKGKMTLP 376 >emb|CBI20322.3| unnamed protein product [Vitis vinifera] Length = 687 Score = 69.3 bits (168), Expect = 3e-10 Identities = 31/49 (63%), Positives = 36/49 (73%) Frame = +3 Query: 6 LLKEWESSGNIYDFRVPNVLLGAYTKRGCTEKAEAMLEDLTNNGKVPIP 152 LLKEWESSGN YDFRVPN LL + ++G EKAE+ML D+ GK P P Sbjct: 335 LLKEWESSGNCYDFRVPNTLLIGFCQKGLIEKAESMLRDIVEEGKTPTP 383 >ref|XP_002282230.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21705, mitochondrial [Vitis vinifera] Length = 504 Score = 69.3 bits (168), Expect = 3e-10 Identities = 31/49 (63%), Positives = 36/49 (73%) Frame = +3 Query: 6 LLKEWESSGNIYDFRVPNVLLGAYTKRGCTEKAEAMLEDLTNNGKVPIP 152 LLKEWESSGN YDFRVPN LL + ++G EKAE+ML D+ GK P P Sbjct: 335 LLKEWESSGNCYDFRVPNTLLIGFCQKGLIEKAESMLRDIVEEGKTPTP 383 >ref|XP_003632962.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21705, mitochondrial-like [Vitis vinifera] Length = 506 Score = 68.6 bits (166), Expect = 5e-10 Identities = 29/50 (58%), Positives = 40/50 (80%) Frame = +3 Query: 3 KLLKEWESSGNIYDFRVPNVLLGAYTKRGCTEKAEAMLEDLTNNGKVPIP 152 K+L+EWESSGN YDFRVPN+++ Y+++G EKAEAML++L GK+ P Sbjct: 337 KVLREWESSGNCYDFRVPNIVIIGYSEKGLFEKAEAMLKELMEKGKITTP 386 >emb|CAN64166.1| hypothetical protein VITISV_006333 [Vitis vinifera] Length = 506 Score = 68.6 bits (166), Expect = 5e-10 Identities = 29/50 (58%), Positives = 40/50 (80%) Frame = +3 Query: 3 KLLKEWESSGNIYDFRVPNVLLGAYTKRGCTEKAEAMLEDLTNNGKVPIP 152 K+L+EWESSGN YDFRVPN+++ Y+++G EKAEAML++L GK+ P Sbjct: 337 KVLREWESSGNCYDFRVPNIVIIGYSEKGLFEKAEAMLKELMEKGKITTP 386