BLASTX nr result
ID: Coptis24_contig00006996
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00006996 (264 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275854.1| PREDICTED: uncharacterized protein LOC100264... 129 3e-28 ref|XP_002520558.1| brg-1 associated factor, putative [Ricinus c... 125 3e-27 gb|AEL98716.1| SWIB complex BAF60b domain-containing protein, pa... 125 4e-27 gb|AEL98715.1| SWIB complex BAF60b domain-containing protein, pa... 125 4e-27 ref|XP_003635018.1| PREDICTED: uncharacterized protein LOC100853... 125 4e-27 >ref|XP_002275854.1| PREDICTED: uncharacterized protein LOC100264067 [Vitis vinifera] gi|297737516|emb|CBI26717.3| unnamed protein product [Vitis vinifera] Length = 331 Score = 129 bits (323), Expect = 3e-28 Identities = 60/76 (78%), Positives = 70/76 (92%) Frame = +2 Query: 2 KQLWAYIRKHNLQDPSNKRKIICNDELRLVFETDCTDMFKMNKLLAKHIIPLDPTKELGQ 181 KQLWAYIR++NLQDPSNKRKIICNDELRLVFETD TDMFKMNKLLAKHIIPL+PTK+ G+ Sbjct: 173 KQLWAYIRRNNLQDPSNKRKIICNDELRLVFETDSTDMFKMNKLLAKHIIPLEPTKQSGE 232 Query: 182 DSKRLKVETESATEST 229 SK+LKV+ + T+S+ Sbjct: 233 QSKKLKVDAGAGTKSS 248 >ref|XP_002520558.1| brg-1 associated factor, putative [Ricinus communis] gi|223540218|gb|EEF41791.1| brg-1 associated factor, putative [Ricinus communis] Length = 397 Score = 125 bits (315), Expect = 3e-27 Identities = 61/75 (81%), Positives = 68/75 (90%) Frame = +2 Query: 2 KQLWAYIRKHNLQDPSNKRKIICNDELRLVFETDCTDMFKMNKLLAKHIIPLDPTKELGQ 181 KQLWAYIRK+NLQDPSNKRKIIC+D LR+VFETDCTDMFKMNKLLAKHIIPL+PTKE Q Sbjct: 239 KQLWAYIRKNNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLLAKHIIPLEPTKESAQ 298 Query: 182 DSKRLKVETESATES 226 +KR KV+ ES TE+ Sbjct: 299 -AKRAKVDVESTTEN 312 >gb|AEL98716.1| SWIB complex BAF60b domain-containing protein, partial [Silene latifolia] Length = 235 Score = 125 bits (314), Expect = 4e-27 Identities = 59/75 (78%), Positives = 64/75 (85%) Frame = +2 Query: 2 KQLWAYIRKHNLQDPSNKRKIICNDELRLVFETDCTDMFKMNKLLAKHIIPLDPTKELGQ 181 KQLWAYIRKHNLQDPSNKRKIICN+ELRLVFE DCTDMF+MNKLLAKHI+ LDPTK+ GQ Sbjct: 115 KQLWAYIRKHNLQDPSNKRKIICNEELRLVFEVDCTDMFQMNKLLAKHILRLDPTKDSGQ 174 Query: 182 DSKRLKVETESATES 226 SK+ KVE S Sbjct: 175 QSKKPKVEESQVPSS 189 >gb|AEL98715.1| SWIB complex BAF60b domain-containing protein, partial [Silene latifolia] Length = 235 Score = 125 bits (314), Expect = 4e-27 Identities = 59/75 (78%), Positives = 64/75 (85%) Frame = +2 Query: 2 KQLWAYIRKHNLQDPSNKRKIICNDELRLVFETDCTDMFKMNKLLAKHIIPLDPTKELGQ 181 KQLWAYIRKHNLQDPSNKRKIICN+ELRLVFE DCTDMF+MNKLLAKHI+ LDPTK+ GQ Sbjct: 115 KQLWAYIRKHNLQDPSNKRKIICNEELRLVFEVDCTDMFQMNKLLAKHILRLDPTKDSGQ 174 Query: 182 DSKRLKVETESATES 226 SK+ KVE S Sbjct: 175 QSKKPKVEESQVPSS 189 >ref|XP_003635018.1| PREDICTED: uncharacterized protein LOC100853436 [Vitis vinifera] gi|297741808|emb|CBI33113.3| unnamed protein product [Vitis vinifera] Length = 344 Score = 125 bits (314), Expect = 4e-27 Identities = 62/76 (81%), Positives = 70/76 (92%) Frame = +2 Query: 2 KQLWAYIRKHNLQDPSNKRKIICNDELRLVFETDCTDMFKMNKLLAKHIIPLDPTKELGQ 181 KQLWAYIRK+NLQDPSNKRKIIC+D LRLVFETD TDMFKMNKLLAKHIIPL+P++E Q Sbjct: 186 KQLWAYIRKNNLQDPSNKRKIICDDALRLVFETDSTDMFKMNKLLAKHIIPLEPSRESSQ 245 Query: 182 DSKRLKVETESATEST 229 +KRLKV+ ESATES+ Sbjct: 246 -AKRLKVDVESATESS 260