BLASTX nr result
ID: Coptis24_contig00006761
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00006761 (302 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521818.1| conserved hypothetical protein [Ricinus comm... 61 1e-07 ref|XP_003616977.1| hypothetical protein MTR_5g086360 [Medicago ... 56 3e-06 ref|XP_002527490.1| conserved hypothetical protein [Ricinus comm... 56 3e-06 >ref|XP_002521818.1| conserved hypothetical protein [Ricinus communis] gi|223539031|gb|EEF40628.1| conserved hypothetical protein [Ricinus communis] Length = 78 Score = 60.8 bits (146), Expect = 1e-07 Identities = 36/61 (59%), Positives = 40/61 (65%) Frame = -1 Query: 218 AGLPFPSWELIIMVWA*VRALLVLECRALRQAGFTEQRSPSALSRGRITG*CLNSPIRAW 39 AGLP PS EL +V A V L+LE R LR+AGFTEQRSP AL G ITG C P AW Sbjct: 9 AGLPAPSGELSFVVLAKVGTTLLLEWRVLREAGFTEQRSPPALDSGWITGSCHLIP--AW 66 Query: 38 I 36 + Sbjct: 67 L 67 >ref|XP_003616977.1| hypothetical protein MTR_5g086360 [Medicago truncatula] gi|355518312|gb|AES99935.1| hypothetical protein MTR_5g086360 [Medicago truncatula] Length = 81 Score = 56.2 bits (134), Expect = 3e-06 Identities = 31/66 (46%), Positives = 39/66 (59%) Frame = +1 Query: 73 VILPRLRAEGERCSVKPA*RSALHSKTNKARTYAQTMIINSQLGKGKPAY*PHKAQPFKT 252 VI P RA G RCS KPA RSAL S+ + + +AQ NSQLG+GKP Y ++ P Sbjct: 16 VIPPLSRARGLRCSAKPASRSALSSRNQETKAFAQIPWPNSQLGEGKPTYCRNQPSPTSH 75 Query: 253 SPNPTI 270 S P + Sbjct: 76 SHVPIL 81 >ref|XP_002527490.1| conserved hypothetical protein [Ricinus communis] gi|223533130|gb|EEF34888.1| conserved hypothetical protein [Ricinus communis] Length = 60 Score = 55.8 bits (133), Expect = 3e-06 Identities = 28/47 (59%), Positives = 30/47 (63%) Frame = -3 Query: 216 WLALSKLGVDYHGLGVGPGLVSLRV*GTASGWLHRAAFTFRSQPWED 76 WLA SKL VD GLG GPG + R GTA GW HRAA T S W+D Sbjct: 3 WLARSKLRVDPCGLGEGPGSMGPRAEGTALGWFHRAAITSLSWQWKD 49