BLASTX nr result
ID: Coptis24_contig00006241
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00006241 (784 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002321284.1| predicted protein [Populus trichocarpa] gi|1... 136 4e-30 ref|XP_002521079.1| conserved hypothetical protein [Ricinus comm... 135 1e-29 ref|XP_002529470.1| conserved hypothetical protein [Ricinus comm... 134 2e-29 emb|CBI40813.3| unnamed protein product [Vitis vinifera] 134 3e-29 ref|XP_002262911.1| PREDICTED: small ubiquitin-related modifier ... 134 3e-29 >ref|XP_002321284.1| predicted protein [Populus trichocarpa] gi|118487404|gb|ABK95530.1| unknown [Populus trichocarpa] gi|222862057|gb|EEE99599.1| predicted protein [Populus trichocarpa] Length = 108 Score = 136 bits (343), Expect = 4e-30 Identities = 66/68 (97%), Positives = 67/68 (98%) Frame = -2 Query: 783 HINLKVKGQDGNEVFFRIKRSTQLRKLMTAYCDRQSVEFNSIAFLFDGRRLRGEQTPDEL 604 HINLKVKGQDGNEVFFRIKRSTQLRKLMTAYCDRQSVEFNSIAFLFDGRRLRGEQTPDEL Sbjct: 26 HINLKVKGQDGNEVFFRIKRSTQLRKLMTAYCDRQSVEFNSIAFLFDGRRLRGEQTPDEL 85 Query: 603 EMEDGDXI 580 +MEDGD I Sbjct: 86 DMEDGDEI 93 >ref|XP_002521079.1| conserved hypothetical protein [Ricinus communis] gi|223539648|gb|EEF41230.1| conserved hypothetical protein [Ricinus communis] Length = 108 Score = 135 bits (339), Expect = 1e-29 Identities = 65/68 (95%), Positives = 67/68 (98%) Frame = -2 Query: 783 HINLKVKGQDGNEVFFRIKRSTQLRKLMTAYCDRQSVEFNSIAFLFDGRRLRGEQTPDEL 604 HINLKVKGQDGNE+FFRIKRSTQLRKL+TAYCDRQSVEFNSIAFLFDGRRLRGEQTPDEL Sbjct: 27 HINLKVKGQDGNEMFFRIKRSTQLRKLITAYCDRQSVEFNSIAFLFDGRRLRGEQTPDEL 86 Query: 603 EMEDGDXI 580 EMEDGD I Sbjct: 87 EMEDGDEI 94 >ref|XP_002529470.1| conserved hypothetical protein [Ricinus communis] gi|223531086|gb|EEF32936.1| conserved hypothetical protein [Ricinus communis] Length = 99 Score = 134 bits (338), Expect = 2e-29 Identities = 65/68 (95%), Positives = 66/68 (97%) Frame = -2 Query: 783 HINLKVKGQDGNEVFFRIKRSTQLRKLMTAYCDRQSVEFNSIAFLFDGRRLRGEQTPDEL 604 HINLKVKGQDGNEVFFRIKRSTQL+KLM AYCDRQSVEFNSIAFLFDGRRLRGEQTPDEL Sbjct: 20 HINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVEFNSIAFLFDGRRLRGEQTPDEL 79 Query: 603 EMEDGDXI 580 EMEDGD I Sbjct: 80 EMEDGDEI 87 >emb|CBI40813.3| unnamed protein product [Vitis vinifera] Length = 91 Score = 134 bits (336), Expect = 3e-29 Identities = 65/68 (95%), Positives = 66/68 (97%) Frame = -2 Query: 783 HINLKVKGQDGNEVFFRIKRSTQLRKLMTAYCDRQSVEFNSIAFLFDGRRLRGEQTPDEL 604 HINLKVKGQDGNEVFFRIKRSTQLRKLM+AYCDRQSVE NSIAFLFDGRRLRGEQTPDEL Sbjct: 6 HINLKVKGQDGNEVFFRIKRSTQLRKLMSAYCDRQSVELNSIAFLFDGRRLRGEQTPDEL 65 Query: 603 EMEDGDXI 580 EMEDGD I Sbjct: 66 EMEDGDEI 73 >ref|XP_002262911.1| PREDICTED: small ubiquitin-related modifier 2 [Vitis vinifera] gi|296090483|emb|CBI40814.3| unnamed protein product [Vitis vinifera] Length = 103 Score = 134 bits (336), Expect = 3e-29 Identities = 65/68 (95%), Positives = 66/68 (97%) Frame = -2 Query: 783 HINLKVKGQDGNEVFFRIKRSTQLRKLMTAYCDRQSVEFNSIAFLFDGRRLRGEQTPDEL 604 HINLKVKGQDGNEVFFRIKRSTQLRKLM+AYCDRQSVE NSIAFLFDGRRLRGEQTPDEL Sbjct: 23 HINLKVKGQDGNEVFFRIKRSTQLRKLMSAYCDRQSVELNSIAFLFDGRRLRGEQTPDEL 82 Query: 603 EMEDGDXI 580 EMEDGD I Sbjct: 83 EMEDGDEI 90