BLASTX nr result
ID: Coptis24_contig00005707
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00005707 (379 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004143761.1| PREDICTED: uncharacterized protein LOC101222... 55 8e-06 >ref|XP_004143761.1| PREDICTED: uncharacterized protein LOC101222479 [Cucumis sativus] gi|449526267|ref|XP_004170135.1| PREDICTED: uncharacterized LOC101222479 [Cucumis sativus] Length = 191 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = -1 Query: 301 PSKRLAIPSLTNPEKPFYGKPSYDGVIAGKVSG 203 P+KR AIPS NP+KP YG P+YDGVI GKVSG Sbjct: 52 PAKRSAIPSSENPDKPTYGNPTYDGVIGGKVSG 84