BLASTX nr result
ID: Coptis24_contig00005577
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00005577 (671 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003522347.1| PREDICTED: calcium-dependent protein kinase ... 114 8e-24 ref|XP_002318616.1| calcium dependent protein kinase 10 [Populus... 112 9e-23 ref|XP_002511506.1| calcium-dependent protein kinase, putative [... 109 9e-23 ref|XP_003528177.1| PREDICTED: calcium-dependent protein kinase ... 110 1e-22 ref|XP_002322129.1| calcium dependent protein kinase 28 [Populus... 110 3e-22 >ref|XP_003522347.1| PREDICTED: calcium-dependent protein kinase 10-like [Glycine max] Length = 556 Score = 114 bits (286), Expect(2) = 8e-24 Identities = 57/70 (81%), Positives = 59/70 (84%) Frame = +2 Query: 2 YIEREELCAALVDESGEVDIEVLNDIINEVDTDMDGCISYEEFVAMMKTGTDWRKASHHY 181 YIE EL AL DESGE D +VLNDI+ EVDTD DGCISYEEFVAMMKTGTDWRKAS Y Sbjct: 466 YIELGELEEALADESGETDADVLNDIMREVDTDKDGCISYEEFVAMMKTGTDWRKASRQY 525 Query: 182 SRERFKSLSL 211 SRERFKSLSL Sbjct: 526 SRERFKSLSL 535 Score = 21.6 bits (44), Expect(2) = 8e-24 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +3 Query: 213 LMKDGSLKVGDGVKFQDTV 269 LMKDGSL++ D + Q V Sbjct: 537 LMKDGSLQLHDEITGQAVV 555 >ref|XP_002318616.1| calcium dependent protein kinase 10 [Populus trichocarpa] gi|222859289|gb|EEE96836.1| calcium dependent protein kinase 10 [Populus trichocarpa] Length = 555 Score = 112 bits (279), Expect = 9e-23 Identities = 55/70 (78%), Positives = 58/70 (82%) Frame = +2 Query: 2 YIEREELCAALVDESGEVDIEVLNDIINEVDTDMDGCISYEEFVAMMKTGTDWRKASHHY 181 YIE +EL AL DE GE D +VLNDI+ EVDTD DGCISYEEFVAMMK GTDWRKAS Y Sbjct: 465 YIELDELRGALADEYGETDNDVLNDIMREVDTDKDGCISYEEFVAMMKAGTDWRKASRQY 524 Query: 182 SRERFKSLSL 211 SRERFKSLSL Sbjct: 525 SRERFKSLSL 534 >ref|XP_002511506.1| calcium-dependent protein kinase, putative [Ricinus communis] gi|223550621|gb|EEF52108.1| calcium-dependent protein kinase, putative [Ricinus communis] Length = 549 Score = 109 bits (273), Expect(2) = 9e-23 Identities = 54/70 (77%), Positives = 57/70 (81%) Frame = +2 Query: 2 YIEREELCAALVDESGEVDIEVLNDIINEVDTDMDGCISYEEFVAMMKTGTDWRKASHHY 181 YIE EEL AL DE GE D +VL+DI+ EVDTD DGCISYEEFV MMK GTDWRKAS Y Sbjct: 459 YIELEELREALADEYGETDNDVLHDILREVDTDKDGCISYEEFVVMMKAGTDWRKASRQY 518 Query: 182 SRERFKSLSL 211 SRERFKSLSL Sbjct: 519 SRERFKSLSL 528 Score = 23.1 bits (48), Expect(2) = 9e-23 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = +3 Query: 213 LMKDGSLKVGDGVKFQ 260 LMKDGSL++ DG+ Q Sbjct: 530 LMKDGSLQLHDGLTGQ 545 >ref|XP_003528177.1| PREDICTED: calcium-dependent protein kinase 30-like [Glycine max] Length = 551 Score = 110 bits (276), Expect(2) = 1e-22 Identities = 56/70 (80%), Positives = 58/70 (82%) Frame = +2 Query: 2 YIEREELCAALVDESGEVDIEVLNDIINEVDTDMDGCISYEEFVAMMKTGTDWRKASHHY 181 YIE EL AL DESGE D +VLNDI+ EVDTD DG ISYEEFVAMMKTGTDWRKAS Y Sbjct: 461 YIELRELEEALADESGETDADVLNDIMREVDTDKDGRISYEEFVAMMKTGTDWRKASRQY 520 Query: 182 SRERFKSLSL 211 SRERFKSLSL Sbjct: 521 SRERFKSLSL 530 Score = 21.6 bits (44), Expect(2) = 1e-22 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +3 Query: 213 LMKDGSLKVGDGVKFQDTV 269 LMKDGSL++ D + Q V Sbjct: 532 LMKDGSLQLHDEITGQAVV 550 >ref|XP_002322129.1| calcium dependent protein kinase 28 [Populus trichocarpa] gi|222869125|gb|EEF06256.1| calcium dependent protein kinase 28 [Populus trichocarpa] Length = 562 Score = 110 bits (274), Expect = 3e-22 Identities = 54/70 (77%), Positives = 57/70 (81%) Frame = +2 Query: 2 YIEREELCAALVDESGEVDIEVLNDIINEVDTDMDGCISYEEFVAMMKTGTDWRKASHHY 181 YIE +EL L DE GE D +VLNDI+ EVDTD DGCISYEEFVAMMK GTDWRKAS Y Sbjct: 472 YIELDELREGLADEYGETDDDVLNDIMREVDTDKDGCISYEEFVAMMKAGTDWRKASRQY 531 Query: 182 SRERFKSLSL 211 SRERFKSLSL Sbjct: 532 SRERFKSLSL 541