BLASTX nr result
ID: Coptis24_contig00005471
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00005471 (254 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270788.1| PREDICTED: pentatricopeptide repeat-containi... 66 3e-09 gb|ABD33237.1| Pentatricopeptide repeat [Medicago truncatula] 61 1e-07 ref|XP_003616089.1| Pentatricopeptide repeat-containing protein ... 60 2e-07 ref|XP_003616088.1| Pentatricopeptide repeat-containing protein ... 60 2e-07 ref|XP_003553441.1| PREDICTED: pentatricopeptide repeat-containi... 58 9e-07 >ref|XP_002270788.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30780 [Vitis vinifera] gi|296086664|emb|CBI32299.3| unnamed protein product [Vitis vinifera] Length = 494 Score = 66.2 bits (160), Expect = 3e-09 Identities = 31/51 (60%), Positives = 36/51 (70%) Frame = -1 Query: 251 EMERFNFDPTKKTFLIMYKAYSHWGQRSRVMRLLGTMCKHGFQIPSDAFFS 99 EME NF TKKTF I+YKAYS W QR +V ++ G MCKHG+ IPSD S Sbjct: 444 EMESSNFCCTKKTFWILYKAYSMWDQRHKVEQVKGLMCKHGYGIPSDVLLS 494 >gb|ABD33237.1| Pentatricopeptide repeat [Medicago truncatula] Length = 514 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/50 (56%), Positives = 36/50 (72%) Frame = -1 Query: 254 KEMERFNFDPTKKTFLIMYKAYSHWGQRSRVMRLLGTMCKHGFQIPSDAF 105 +EM+ N TKKT IMYKAY + GQRS V+++LG M KHG ++P DAF Sbjct: 463 EEMDSVNIQRTKKTMWIMYKAYWNCGQRSMVLKILGQMFKHGHEVPIDAF 512 >ref|XP_003616089.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355517424|gb|AES99047.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 552 Score = 59.7 bits (143), Expect = 2e-07 Identities = 28/50 (56%), Positives = 35/50 (70%) Frame = -1 Query: 254 KEMERFNFDPTKKTFLIMYKAYSHWGQRSRVMRLLGTMCKHGFQIPSDAF 105 +EM+ N TKKT IMYKAY GQRS V+++LG M KHG ++P DAF Sbjct: 501 EEMDSVNMQRTKKTLWIMYKAYWSCGQRSLVLKILGQMFKHGHEVPIDAF 550 >ref|XP_003616088.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355517423|gb|AES99046.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 494 Score = 59.7 bits (143), Expect = 2e-07 Identities = 28/50 (56%), Positives = 35/50 (70%) Frame = -1 Query: 254 KEMERFNFDPTKKTFLIMYKAYSHWGQRSRVMRLLGTMCKHGFQIPSDAF 105 +EM+ N TKKT IMYKAY GQRS V+++LG M KHG ++P DAF Sbjct: 443 EEMDSVNMQRTKKTLWIMYKAYWSCGQRSLVLKILGQMFKHGHEVPIDAF 492 >ref|XP_003553441.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30780-like [Glycine max] Length = 504 Score = 57.8 bits (138), Expect = 9e-07 Identities = 27/50 (54%), Positives = 34/50 (68%) Frame = -1 Query: 254 KEMERFNFDPTKKTFLIMYKAYSHWGQRSRVMRLLGTMCKHGFQIPSDAF 105 +EME N + TKKT IMYKAY GQ S V++ LG M KHG+++P AF Sbjct: 453 EEMEMVNLECTKKTLWIMYKAYMRNGQSSMVLKTLGQMFKHGYEVPLSAF 502