BLASTX nr result
ID: Coptis24_contig00005365
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00005365 (220 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517743.1| conserved hypothetical protein [Ricinus comm... 62 6e-08 ref|XP_003518333.1| PREDICTED: E3 ubiquitin-protein ligase liste... 61 1e-07 ref|XP_003615959.1| RING finger protein [Medicago truncatula] gi... 61 1e-07 ref|NP_200649.1| HEAT/U-box domain-containing protein [Arabidops... 60 1e-07 ref|XP_002864573.1| binding protein [Arabidopsis lyrata subsp. l... 59 4e-07 >ref|XP_002517743.1| conserved hypothetical protein [Ricinus communis] gi|223543141|gb|EEF44675.1| conserved hypothetical protein [Ricinus communis] Length = 1912 Score = 61.6 bits (148), Expect = 6e-08 Identities = 32/52 (61%), Positives = 38/52 (73%), Gaps = 2/52 (3%) Frame = +3 Query: 3 ETMAALGGAIYGLMIRALPAYVRDWFASLRDKSTS--IASFTKTCVSANLYV 152 E MA+L GAI+GLM+R LPAYVR WF LRD+STS I +FT+T S L V Sbjct: 1704 EKMASLSGAIFGLMLRVLPAYVRGWFTDLRDRSTSSLIETFTRTWCSPPLIV 1755 >ref|XP_003518333.1| PREDICTED: E3 ubiquitin-protein ligase listerin-like [Glycine max] Length = 1885 Score = 60.8 bits (146), Expect = 1e-07 Identities = 29/48 (60%), Positives = 38/48 (79%), Gaps = 2/48 (4%) Frame = +3 Query: 9 MAALGGAIYGLMIRALPAYVRDWFASLRDKSTS--IASFTKTCVSANL 146 +++L GAIYGLM++ LPAYVR WF+ LRD++TS I SFT+TC S L Sbjct: 1679 ISSLAGAIYGLMLQVLPAYVRGWFSDLRDRNTSAVIESFTRTCCSPPL 1726 >ref|XP_003615959.1| RING finger protein [Medicago truncatula] gi|355517294|gb|AES98917.1| RING finger protein [Medicago truncatula] Length = 1683 Score = 60.8 bits (146), Expect = 1e-07 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 2/50 (4%) Frame = +3 Query: 3 ETMAALGGAIYGLMIRALPAYVRDWFASLRDK--STSIASFTKTCVSANL 146 E +++L GAIYGLM+ LPAYVR WF LRD+ ST+I SFT+TC S L Sbjct: 1475 EKISSLAGAIYGLMLHVLPAYVRGWFNDLRDRNISTAIESFTRTCCSPPL 1524 >ref|NP_200649.1| HEAT/U-box domain-containing protein [Arabidopsis thaliana] gi|75309054|sp|Q9FGI1.1|LTN1_ARATH RecName: Full=E3 ubiquitin-protein ligase listerin gi|10177018|dbj|BAB10256.1| unnamed protein product [Arabidopsis thaliana] gi|332009666|gb|AED97049.1| HEAT/U-box domain-containing protein [Arabidopsis thaliana] Length = 1873 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/48 (60%), Positives = 38/48 (79%), Gaps = 2/48 (4%) Frame = +3 Query: 9 MAALGGAIYGLMIRALPAYVRDWFASLRDKSTS--IASFTKTCVSANL 146 MA+L GAIYGLM+R LPAYVR+WF+ +RD+S S I +FT+T S +L Sbjct: 1667 MASLAGAIYGLMLRVLPAYVREWFSEMRDRSASSLIEAFTRTWCSPSL 1714 >ref|XP_002864573.1| binding protein [Arabidopsis lyrata subsp. lyrata] gi|297310408|gb|EFH40832.1| binding protein [Arabidopsis lyrata subsp. lyrata] Length = 1871 Score = 58.9 bits (141), Expect = 4e-07 Identities = 28/48 (58%), Positives = 38/48 (79%), Gaps = 2/48 (4%) Frame = +3 Query: 9 MAALGGAIYGLMIRALPAYVRDWFASLRDKSTS--IASFTKTCVSANL 146 MA+L GAIYGLM+R LPAYVR+WF+ +RD+S S I +FT++ S +L Sbjct: 1665 MASLAGAIYGLMLRVLPAYVREWFSEMRDRSASSLIEAFTRSWCSPSL 1712